Gene Information

Name : Adeh_2914 (Adeh_2914)
Accession : YP_466121.1
Strain : Anaeromyxobacter dehalogenans 2CP-C
Genome accession: NC_007760
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3289712 - 3290449 bp
Length : 738 bp
Strand : +
Note : -

DNA sequence :
GTGACGGCGCCCGCCCCACGCTATGATGCCGCGGTGACCGCCGCGACCCCGCTCCTCGCGCTGCTCGTCGAGGACGACCT
CCGCCTCGCCGCGTTCACCCGCGAGTACCTGGAGGGCCACGGCGTGGCGGTGGTCCACGTCACCGACGGGCGCCGCGGGC
TCGACGAGGCGCTCGCGGGGCGCTTCGACGTGGTGCTGCTCGACCTCATGCTGCCGGGGAAGGACGGCCTGGAGGTCTGC
CGCGAGCTCCGGTCGCGCTCCGACGTCCCGGTCATCGTCCTCACCGCGCGCGGCGAGGAGGCGGACCGCGTGATGGGGCT
CGAGCTCGGCGCGGACGACTACCTGGCGAAGCCGTTCTCGCCCCGCGAGCTGCTCGCGCGCATCCGCGCCGTGGTGCGGC
GAGCGACCGGGCGCGCCGGGCCGCCCCGCGAGGCGGTGCGGGTCGGCGGCCTGGTGGTGGATCCGGCGGCGCGCCGGGTG
ACGCTGGACGGGCGCGAGGTGACGCTCACCGGGTACGAGTTCGCGCTGCTCCACGCGCTGGCGCGCCGCGCGGGCCGCGT
GCTCGCCCGGGAGCAGCTCATCGAGCTGGCGGGCGGGAGCGCCGAGGAGGCGTTCGACCGCTCGGTGGACGTGCACGTCT
CCCGGCTGCGGCAGAAGCTCGGCGACGATCCCCGGCGGCCCCGGCTCATCAAGACGGTCCGCGGCGCCGGGTACCTGCTC
GCCGGGGAGCCGGGATGA

Protein sequence :
MTAPAPRYDAAVTAATPLLALLVEDDLRLAAFTREYLEGHGVAVVHVTDGRRGLDEALAGRFDVVLLDLMLPGKDGLEVC
RELRSRSDVPVIVLTARGEEADRVMGLELGADDYLAKPFSPRELLARIRAVVRRATGRAGPPREAVRVGGLVVDPAARRV
TLDGREVTLTGYEFALLHALARRAGRVLAREQLIELAGGSAEEAFDRSVDVHVSRLRQKLGDDPRRPRLIKTVRGAGYLL
AGEPG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-19 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Adeh_2914 YP_466121.1 two component transcriptional regulator AE000516.2.gene3505. Protein 7e-25 46
Adeh_2914 YP_466121.1 two component transcriptional regulator CP000034.1.gene3834. Protein 1e-20 45
Adeh_2914 YP_466121.1 two component transcriptional regulator NC_002695.1.915041.p Protein 1e-20 45
Adeh_2914 YP_466121.1 two component transcriptional regulator CP004022.1.gene3215. Protein 6e-24 44
Adeh_2914 YP_466121.1 two component transcriptional regulator CP001485.1.gene721.p Protein 2e-20 44
Adeh_2914 YP_466121.1 two component transcriptional regulator CP000675.2.gene1535. Protein 1e-30 43
Adeh_2914 YP_466121.1 two component transcriptional regulator NC_008702.1.4607594. Protein 7e-31 43
Adeh_2914 YP_466121.1 two component transcriptional regulator BAC0125 Protein 4e-18 42
Adeh_2914 YP_466121.1 two component transcriptional regulator BAC0111 Protein 2e-17 42
Adeh_2914 YP_466121.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 4e-23 42
Adeh_2914 YP_466121.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-23 42
Adeh_2914 YP_466121.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-23 42
Adeh_2914 YP_466121.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-23 42
Adeh_2914 YP_466121.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-23 42
Adeh_2914 YP_466121.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-23 42
Adeh_2914 YP_466121.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-23 42
Adeh_2914 YP_466121.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-23 42
Adeh_2914 YP_466121.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-23 42
Adeh_2914 YP_466121.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-23 42
Adeh_2914 YP_466121.1 two component transcriptional regulator AE016830.1.gene1681. Protein 2e-23 42
Adeh_2914 YP_466121.1 two component transcriptional regulator HE999704.1.gene2815. Protein 5e-22 42
Adeh_2914 YP_466121.1 two component transcriptional regulator HE999704.1.gene1528. Protein 1e-18 42
Adeh_2914 YP_466121.1 two component transcriptional regulator BAC0197 Protein 4e-16 41
Adeh_2914 YP_466121.1 two component transcriptional regulator NC_012469.1.7685629. Protein 2e-20 41
Adeh_2914 YP_466121.1 two component transcriptional regulator BAC0347 Protein 5e-16 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Adeh_2914 YP_466121.1 two component transcriptional regulator VFG1389 Protein 1e-17 45
Adeh_2914 YP_466121.1 two component transcriptional regulator VFG1390 Protein 1e-19 44
Adeh_2914 YP_466121.1 two component transcriptional regulator VFG0596 Protein 3e-19 42
Adeh_2914 YP_466121.1 two component transcriptional regulator VFG1702 Protein 2e-23 41