Gene Information

Name : ELI_03645 (ELI_03645)
Accession : YP_457618.1
Strain : Erythrobacter litoralis HTCC2594
Genome accession: NC_007722
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 752823 - 753500 bp
Length : 678 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGCGCATCCTGATTGTCGAGGACGAACCGACGCTGGGCCAGCAGCTCAAGAGTACGCTGGAGCAGAACGGTTATGCCGT
GGACTTGTCGACCGATGGCGAGGACGGCCACTTTCTCGGTAGCACCGAAGATTACGATGCCGTGATTCTCGACCTTGGCC
TGCCGGAGATCGACGGGCTGACCGTACTCGGCATGTGGCGCAAGGAAGGCCGCGACTTTCCGGTCCTGGTGCTAACGGCG
CGCGACAGCTGGTCGGACAAGGTGGCAGGTCTCGACGCGGGGGCCGACGATTATCTCGCCAAACCGTTCCAGACCGAGGA
ATTGATCGCGCGGCTACGCGCTTTGATCCGCCGCGCTTCGGGCAACACGTCCAGCGAGCTGACCGCCGGCGATGTCCGGC
TGGACACCCGTTCGGGCCGCGTTTCGCTAAAGGGCGAGCCGGTCAAGCTGACGGCGCAAGAATACAAGCTGCTGAGCTAT
CTGATGCACCACAAGGGCAAGGTGGTCAGCCGTACCGAACTGATCGAGCATATCTACGATCAGGATTTCGACCGCGATTC
CAATACGATCGAGGTTTTTGTAACGCGCATCCGCAAGAAATTGGGCGCAGAAGTGATTACGACGATCCGTGGACTCGGCT
ACAGCCTCGACGACCCGGCCGACGCGCCGCGGGCCTGA

Protein sequence :
MRILIVEDEPTLGQQLKSTLEQNGYAVDLSTDGEDGHFLGSTEDYDAVILDLGLPEIDGLTVLGMWRKEGRDFPVLVLTA
RDSWSDKVAGLDAGADDYLAKPFQTEELIARLRALIRRASGNTSSELTAGDVRLDTRSGRVSLKGEPVKLTAQEYKLLSY
LMHHKGKVVSRTELIEHIYDQDFDRDSNTIEVFVTRIRKKLGAEVITTIRGLGYSLDDPADAPRA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 2e-24 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ELI_03645 YP_457618.1 two-component response regulator NC_002516.2.879194.p Protein 9e-33 46
ELI_03645 YP_457618.1 two-component response regulator BAC0487 Protein 8e-26 45
ELI_03645 YP_457618.1 two-component response regulator CP000034.1.gene2022. Protein 7e-31 43
ELI_03645 YP_457618.1 two-component response regulator NC_002695.1.913289.p Protein 4e-31 43
ELI_03645 YP_457618.1 two-component response regulator CP000647.1.gene1136. Protein 9e-32 43
ELI_03645 YP_457618.1 two-component response regulator CP001918.1.gene2526. Protein 2e-30 43
ELI_03645 YP_457618.1 two-component response regulator CP004022.1.gene1005. Protein 5e-31 43
ELI_03645 YP_457618.1 two-component response regulator CP001138.1.gene1939. Protein 3e-31 43
ELI_03645 YP_457618.1 two-component response regulator BAC0530 Protein 8e-32 43
ELI_03645 YP_457618.1 two-component response regulator BAC0308 Protein 5e-22 42
ELI_03645 YP_457618.1 two-component response regulator BAC0347 Protein 5e-23 41
ELI_03645 YP_457618.1 two-component response regulator BAC0125 Protein 9e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ELI_03645 YP_457618.1 two-component response regulator VFG0473 Protein 8e-24 45
ELI_03645 YP_457618.1 two-component response regulator VFG0475 Protein 3e-31 43
ELI_03645 YP_457618.1 two-component response regulator VFG1390 Protein 2e-21 41