Gene Information

Name : drrA (SRU_2488)
Accession : YP_446586.1
Strain : Salinibacter ruber DSM 13855
Genome accession: NC_007677
Putative virulence/resistance : Virulence
Product : response regulator DrrA
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3092596 - 3093333 bp
Length : 738 bp
Strand : -
Note : identified by match to protein family HMM PF00072; match to protein family HMM PF00486

DNA sequence :
GTGACGACCGCCGCCGAGAAGCGCATTCTGCTCGTCGAGGATGACGACGACATCGCGGACCTGCTGGAGCTGCACCTCAC
CGACGCGGGGCACGCGGTCGACGTGGTTGGGGACGGCGACGACGGGCTGGCGCGGGCGTTGACCGAGGCGTACGACCTCA
TCGTCCTCGACATCATGCTGCCCGGCACCGACGGCTTCGACATCTGCCGCCGGCTGCGCCAGGAGAAGTGCCCGACGCCC
ATTCTCATGGTGACGGCCAAGACCGAAGAGGTGGACAAGGTGCTGGGGCTGGAGCTGGGGGCCGACGATTACATCACCAA
GCCGTTTAGCATCCGCGAGGTGCTGGCCCGGGTGAAGGCCCTCTTTCGGCGCGTGGAGGTGGACCAGGAGACGCAGGGGC
AGGCCGACGACACGCCCATTGAGCTCGGGAAGGTCGTCGTTGAGCCGGAAAAGCGCAAGGTGACCGTCGAGGGGGAGGCC
GTCGACCTTACGAGCAAAGAGTTCGAGCTGCTGCTTCTCTTTGCCCGGCACCCGGGGCGGGCCTTCAGTCGCGACGAGCT
GCTCGACGAGGTGTGGGGCTACCAGTACAGCGGGTACAGCCACACCGTCAACACCCACATCAACCGCCTCCGCAACAAGA
TTGAGCCGGACCCCTCCGAGCCCCGGTACGTGAAGACGGTGTGGGGGGTGGGCTACCGGTTCGCCGAGCGGGAGGAATTG
GCGGCGCGTGATGTGTAA

Protein sequence :
MTTAAEKRILLVEDDDDIADLLELHLTDAGHAVDVVGDGDDGLARALTEAYDLIVLDIMLPGTDGFDICRRLRQEKCPTP
ILMVTAKTEEVDKVLGLELGADDYITKPFSIREVLARVKALFRRVEVDQETQGQADDTPIELGKVVVEPEKRKVTVEGEA
VDLTSKEFELLLLFARHPGRAFSRDELLDEVWGYQYSGYSHTVNTHINRLRNKIEPDPSEPRYVKTVWGVGYRFAEREEL
AARDV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-47 53
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-46 53
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
drrA YP_446586.1 response regulator DrrA AE016830.1.gene1681. Protein 1e-48 51
drrA YP_446586.1 response regulator DrrA HE999704.1.gene2815. Protein 3e-48 51
drrA YP_446586.1 response regulator DrrA NC_002952.2859905.p0 Protein 5e-43 48
drrA YP_446586.1 response regulator DrrA NC_002758.1121668.p0 Protein 3e-43 48
drrA YP_446586.1 response regulator DrrA NC_009641.5332272.p0 Protein 3e-43 48
drrA YP_446586.1 response regulator DrrA NC_013450.8614421.p0 Protein 3e-43 48
drrA YP_446586.1 response regulator DrrA NC_007793.3914279.p0 Protein 3e-43 48
drrA YP_446586.1 response regulator DrrA NC_007622.3794472.p0 Protein 5e-43 48
drrA YP_446586.1 response regulator DrrA NC_002745.1124361.p0 Protein 3e-43 48
drrA YP_446586.1 response regulator DrrA NC_009782.5559369.p0 Protein 3e-43 48
drrA YP_446586.1 response regulator DrrA NC_002951.3237708.p0 Protein 3e-43 48
drrA YP_446586.1 response regulator DrrA NC_003923.1003749.p0 Protein 3e-43 48
drrA YP_446586.1 response regulator DrrA NC_012469.1.7685629. Protein 3e-38 48
drrA YP_446586.1 response regulator DrrA NC_012469.1.7686381. Protein 3e-46 47
drrA YP_446586.1 response regulator DrrA CP000034.1.gene3671. Protein 8e-44 47
drrA YP_446586.1 response regulator DrrA AE000516.2.gene3505. Protein 2e-35 47
drrA YP_446586.1 response regulator DrrA HE999704.1.gene1528. Protein 1e-30 45
drrA YP_446586.1 response regulator DrrA CP001138.1.gene2239. Protein 3e-33 45
drrA YP_446586.1 response regulator DrrA CP000034.1.gene2186. Protein 1e-33 45
drrA YP_446586.1 response regulator DrrA NC_002695.1.916589.p Protein 8e-34 45
drrA YP_446586.1 response regulator DrrA BAC0596 Protein 3e-33 45
drrA YP_446586.1 response regulator DrrA BAC0039 Protein 1e-33 45
drrA YP_446586.1 response regulator DrrA AF155139.2.orf0.gene Protein 3e-37 44
drrA YP_446586.1 response regulator DrrA AM180355.1.gene1830. Protein 1e-35 44
drrA YP_446586.1 response regulator DrrA CP001918.1.gene3444. Protein 1e-32 44
drrA YP_446586.1 response regulator DrrA AE015929.1.gene1106. Protein 3e-32 43
drrA YP_446586.1 response regulator DrrA BAC0197 Protein 1e-32 43
drrA YP_446586.1 response regulator DrrA DQ212986.1.gene4.p01 Protein 3e-35 43
drrA YP_446586.1 response regulator DrrA CP004022.1.gene1676. Protein 6e-31 43
drrA YP_446586.1 response regulator DrrA AF130997.1.orf0.gene Protein 1e-30 43
drrA YP_446586.1 response regulator DrrA FJ349556.1.orf0.gene Protein 3e-38 42
drrA YP_446586.1 response regulator DrrA NC_007622.3794948.p0 Protein 3e-36 42
drrA YP_446586.1 response regulator DrrA NC_003923.1003417.p0 Protein 3e-36 42
drrA YP_446586.1 response regulator DrrA NC_013450.8614146.p0 Protein 3e-36 42
drrA YP_446586.1 response regulator DrrA NC_002951.3238224.p0 Protein 3e-36 42
drrA YP_446586.1 response regulator DrrA NC_007793.3914065.p0 Protein 3e-36 42
drrA YP_446586.1 response regulator DrrA NC_002758.1121390.p0 Protein 3e-36 42
drrA YP_446586.1 response regulator DrrA NC_010079.5776364.p0 Protein 3e-36 42
drrA YP_446586.1 response regulator DrrA NC_002952.2859858.p0 Protein 3e-36 42
drrA YP_446586.1 response regulator DrrA EU250284.1.orf4.gene Protein 4e-33 42
drrA YP_446586.1 response regulator DrrA AF162694.1.orf4.gene Protein 5e-31 42
drrA YP_446586.1 response regulator DrrA NC_005054.2598277.p0 Protein 2e-32 42
drrA YP_446586.1 response regulator DrrA NC_014475.1.orf0.gen Protein 2e-32 42
drrA YP_446586.1 response regulator DrrA CP000647.1.gene2531. Protein 8e-32 42
drrA YP_446586.1 response regulator DrrA BAC0083 Protein 3e-34 41
drrA YP_446586.1 response regulator DrrA BAC0111 Protein 6e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
drrA YP_446586.1 response regulator DrrA VFG1563 Protein 3e-47 53
drrA YP_446586.1 response regulator DrrA VFG1702 Protein 9e-47 53
drrA YP_446586.1 response regulator DrrA VFG0596 Protein 6e-28 41