Gene Information

Name : cadR (BTH_I3291)
Accession : YP_443783.1
Strain :
Genome accession: NC_007651
Putative virulence/resistance : Resistance
Product : Cd(II)/Pb(II)-responsive transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 3747404 - 3747835 bp
Length : 432 bp
Strand : +
Note : identified by match to protein family HMM PF00376; match to protein family HMM TIGR02047

DNA sequence :
ATGAAGATCGGCGAACTTGCGAAAGCGGCGCGGTGCACGCCCGAGACGATTCGTTTCTACGAAAAAGAGGGGCTGATGCC
GGGCGCGGAACGGACCGATTCCAACTACCGCCACTACACCGACGCGCATGTCGAGCGGCTGCGCTTCATCCGCAATTGCC
GCGCCCTCGACATGACGCACGACGAGATCCGCGCACTGTTGCGCTTCACCGACGATCCGGCGGATCGCTGCGATTCGGTC
AACGCGCTGCTCGACGAGCACATCGGTCACGTCAACACGCGGCTTGCCGAACTGCAGCACTTGCGCACGCAATTGATCGA
ATTGCGCGAACGGTGCCAGGGCGAGCATGCGGTCGAGGACTGCGGAATCGTGCACGGCCTCGCGACGATGGAAACGCCGA
ACATGCCGGGCAAGCGCTCGCACGTCGGCTGA

Protein sequence :
MKIGELAKAARCTPETIRFYEKEGLMPGAERTDSNYRHYTDAHVERLRFIRNCRALDMTHDEIRALLRFTDDPADRCDSV
NALLDEHIGHVNTRLAELQHLRTQLIELRERCQGEHAVEDCGIVHGLATMETPNMPGKRSHVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 7e-31 50
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 1e-33 50
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 9e-34 50
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 6e-34 50
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 6e-34 50
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 2e-33 49
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 2e-33 49
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 1e-33 49

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cadR YP_443783.1 Cd(II)/Pb(II)-responsive transcriptional regulator BAC0058 Protein 2e-38 59
cadR YP_443783.1 Cd(II)/Pb(II)-responsive transcriptional regulator BAC0301 Protein 1e-31 54