Gene Information

Name : Moth_0070 (Moth_0070)
Accession : YP_428952.1
Strain : Moorella thermoacetica ATCC 39073
Genome accession: NC_007644
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 71329 - 72018 bp
Length : 690 bp
Strand : +
Note : -

DNA sequence :
GTGATAAAACTGCCTAAAATACTGGTAGTTGATGATGAGCCGGCTATTGTGGAGCTGGTAAAATTTAACCTGGAACAGGC
GGGTTTTACCACCATAACTGCCAGTGACGGTGCGGAAGCACTGCAGAAAGCTGAGGCCGAAAAACCCGACCTCATTATCC
TGGACGTGATGTTGCCGAAGGTAGACGGTTTTGAGGTCTGCCGGAGCCTCAGGGCCAGGGGCAGCATGCCTATTTTGATG
CTGACGGCCCGCCGGGAAGAGGTGGACCGTGTCCTGGGCCTGGAATTGGGGGCCGACGACTACCTGACCAAACCCTTCAG
CCCCCGGGAACTGGTTGCCAGGGTGCGGGCAATTCTACGTCGGGTTGCGGAAAAACAGCAACAGAACGATGGTATAATTA
CCGTCGGCGACCTGGTGATAAACCCCGCCAGCCATCTGGTGACGGTACGGGGTAAACCGGTGGATCTCACCTTGAAAGAG
TACCAGCTTTTACAACTCCTGGCGGAAAACCGGGGCCGGGTTTTTAGCCGGGAAGCCCTCCTGGAACGTTTATGGGAAGG
GGAATACTATGGTGACACCCGGACCATAGACGTTCATATCCGGCATCTGCGGGAGAAGATAGAAGCAAACCCCAGTAATC
CCCGCTATATCATTACCGTCCGCGGGGTGGGCTATAAATTTCGTGACTAG

Protein sequence :
MIKLPKILVVDDEPAIVELVKFNLEQAGFTTITASDGAEALQKAEAEKPDLIILDVMLPKVDGFEVCRSLRARGSMPILM
LTARREEVDRVLGLELGADDYLTKPFSPRELVARVRAILRRVAEKQQQNDGIITVGDLVINPASHLVTVRGKPVDLTLKE
YQLLQLLAENRGRVFSREALLERLWEGEYYGDTRTIDVHIRHLREKIEANPSNPRYIITVRGVGYKFRD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-34 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-34 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Moth_0070 YP_428952.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 4e-47 56
Moth_0070 YP_428952.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-47 56
Moth_0070 YP_428952.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-47 56
Moth_0070 YP_428952.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-47 56
Moth_0070 YP_428952.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-47 56
Moth_0070 YP_428952.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-47 56
Moth_0070 YP_428952.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-47 56
Moth_0070 YP_428952.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-47 56
Moth_0070 YP_428952.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-47 56
Moth_0070 YP_428952.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-47 56
Moth_0070 YP_428952.1 two component transcriptional regulator HE999704.1.gene2815. Protein 5e-48 54
Moth_0070 YP_428952.1 two component transcriptional regulator NC_012469.1.7685629. Protein 2e-44 51
Moth_0070 YP_428952.1 two component transcriptional regulator NC_012469.1.7686381. Protein 2e-39 49
Moth_0070 YP_428952.1 two component transcriptional regulator AE016830.1.gene1681. Protein 5e-45 46
Moth_0070 YP_428952.1 two component transcriptional regulator CP004022.1.gene3215. Protein 9e-26 45
Moth_0070 YP_428952.1 two component transcriptional regulator DQ212986.1.gene4.p01 Protein 7e-38 45
Moth_0070 YP_428952.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 3e-40 45
Moth_0070 YP_428952.1 two component transcriptional regulator BAC0083 Protein 6e-26 44
Moth_0070 YP_428952.1 two component transcriptional regulator CP000034.1.gene3834. Protein 7e-23 44
Moth_0070 YP_428952.1 two component transcriptional regulator NC_002695.1.915041.p Protein 7e-23 44
Moth_0070 YP_428952.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 7e-38 44
Moth_0070 YP_428952.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 7e-38 44
Moth_0070 YP_428952.1 two component transcriptional regulator BAC0039 Protein 3e-31 44
Moth_0070 YP_428952.1 two component transcriptional regulator CP001918.1.gene3444. Protein 8e-31 44
Moth_0070 YP_428952.1 two component transcriptional regulator CP000034.1.gene2186. Protein 3e-31 44
Moth_0070 YP_428952.1 two component transcriptional regulator NC_002695.1.916589.p Protein 3e-31 44
Moth_0070 YP_428952.1 two component transcriptional regulator NC_010400.5986590.p0 Protein 2e-29 43
Moth_0070 YP_428952.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 2e-30 43
Moth_0070 YP_428952.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 2e-30 43
Moth_0070 YP_428952.1 two component transcriptional regulator BAC0111 Protein 3e-26 43
Moth_0070 YP_428952.1 two component transcriptional regulator CP001138.1.gene4273. Protein 6e-22 43
Moth_0070 YP_428952.1 two component transcriptional regulator CP001918.1.gene5135. Protein 2e-17 43
Moth_0070 YP_428952.1 two component transcriptional regulator AM180355.1.gene1830. Protein 1e-35 43
Moth_0070 YP_428952.1 two component transcriptional regulator BAC0638 Protein 8e-23 43
Moth_0070 YP_428952.1 two component transcriptional regulator AE000516.2.gene3505. Protein 3e-40 43
Moth_0070 YP_428952.1 two component transcriptional regulator CP000647.1.gene2531. Protein 3e-31 43
Moth_0070 YP_428952.1 two component transcriptional regulator BAC0596 Protein 1e-29 43
Moth_0070 YP_428952.1 two component transcriptional regulator CP001138.1.gene2239. Protein 1e-29 43
Moth_0070 YP_428952.1 two component transcriptional regulator CP000647.1.gene4257. Protein 2e-21 42
Moth_0070 YP_428952.1 two component transcriptional regulator BAC0125 Protein 9e-29 42
Moth_0070 YP_428952.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 9e-39 42
Moth_0070 YP_428952.1 two component transcriptional regulator BAC0533 Protein 2e-21 42
Moth_0070 YP_428952.1 two component transcriptional regulator EU250284.1.orf4.gene Protein 2e-31 42
Moth_0070 YP_428952.1 two component transcriptional regulator BAC0347 Protein 1e-22 41
Moth_0070 YP_428952.1 two component transcriptional regulator AF162694.1.orf4.gene Protein 3e-30 41
Moth_0070 YP_428952.1 two component transcriptional regulator AF130997.1.orf0.gene Protein 7e-33 41
Moth_0070 YP_428952.1 two component transcriptional regulator BAC0197 Protein 2e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Moth_0070 YP_428952.1 two component transcriptional regulator VFG1389 Protein 2e-26 47
Moth_0070 YP_428952.1 two component transcriptional regulator VFG1390 Protein 6e-32 43
Moth_0070 YP_428952.1 two component transcriptional regulator VFG1563 Protein 1e-34 43
Moth_0070 YP_428952.1 two component transcriptional regulator VFG1702 Protein 1e-34 43