Gene Information

Name : Moth_1478 (Moth_1478)
Accession : YP_430331.1
Strain : Moorella thermoacetica ATCC 39073
Genome accession: NC_007644
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1526259 - 1526981 bp
Length : 723 bp
Strand : -
Note : -

DNA sequence :
ATGGGGAGACCGGCTGCAAGCCTTTGGGTACCAGGCGGCGATATGCGGATCCTGGTCGTTGAGGACGAAACCACCCTGGC
CAATACCCTGGCCCGTTGCCTGCGGGAGGAAGGATACGCCACCGACATTGCCTACGACGGCGAAGAGGGGGTCGCCTTCG
CGGAAACAGTGGTCTATGATTTGATAATTTTGGACCTCATGCTGCCCCGGCTGGATGGCATGGAAGTTATCCGGCGCCTG
CGGAATGAACGCATTGAGACCCCGGTCCTTATGCTGACGGCCCGGGATACGGTGGCCGACAAGGTCAGAGGACTGGATGC
CGGCGCCGACGATTACCTCACCAAGCCCTTTGCCCTGGCTGAACTCCTGGCCCGGGTCCGGGCCCTGCTGCGGCGGGAAA
GCGACAATAAGAGCACTGTCCTGCAGGTCGGGGACCTGGTGATGGACACGGTGTCCCGCCAGGTACGCCGGGGCGACCGG
GAAATTAACCTTACTAATAAGGAATACGCCCTGCTGGAGTACTTGATGCGCAATCCCAACCGGGTCCTGACCCGCACCCA
GATAGCCGAACACGTCTGGGATTATGATTTCAGCGGCATGTCCAATATAGTCGATGTCTATATCCGCTACCTGCGGCGCA
AGATAGACGATAATTTTGAACCCAAGTTACTCTATACCATTCGCGGCAGCGGCTATTGCCTCCGGGAACCTGGTAAAAGC
TAG

Protein sequence :
MGRPAASLWVPGGDMRILVVEDETTLANTLARCLREEGYATDIAYDGEEGVAFAETVVYDLIILDLMLPRLDGMEVIRRL
RNERIETPVLMLTARDTVADKVRGLDAGADDYLTKPFALAELLARVRALLRRESDNKSTVLQVGDLVMDTVSRQVRRGDR
EINLTNKEYALLEYLMRNPNRVLTRTQIAEHVWDYDFSGMSNIVDVYIRYLRRKIDDNFEPKLLYTIRGSGYCLREPGKS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-35 48
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-34 46
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 2e-24 41
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 8e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Moth_1478 YP_430331.1 two component transcriptional regulator BAC0083 Protein 3e-42 53
Moth_1478 YP_430331.1 two component transcriptional regulator BAC0125 Protein 1e-42 52
Moth_1478 YP_430331.1 two component transcriptional regulator BAC0308 Protein 7e-42 52
Moth_1478 YP_430331.1 two component transcriptional regulator BAC0197 Protein 1e-39 52
Moth_1478 YP_430331.1 two component transcriptional regulator BAC0111 Protein 1e-40 49
Moth_1478 YP_430331.1 two component transcriptional regulator HE999704.1.gene1528. Protein 2e-37 48
Moth_1478 YP_430331.1 two component transcriptional regulator BAC0347 Protein 3e-34 47
Moth_1478 YP_430331.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 7e-34 46
Moth_1478 YP_430331.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 7e-34 46
Moth_1478 YP_430331.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 7e-34 46
Moth_1478 YP_430331.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 7e-34 46
Moth_1478 YP_430331.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 7e-34 46
Moth_1478 YP_430331.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 7e-34 46
Moth_1478 YP_430331.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 7e-34 46
Moth_1478 YP_430331.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 7e-34 46
Moth_1478 YP_430331.1 two component transcriptional regulator AE015929.1.gene1106. Protein 1e-28 46
Moth_1478 YP_430331.1 two component transcriptional regulator BAC0638 Protein 3e-33 44
Moth_1478 YP_430331.1 two component transcriptional regulator AE016830.1.gene1681. Protein 5e-36 42
Moth_1478 YP_430331.1 two component transcriptional regulator BAC0288 Protein 4e-29 42
Moth_1478 YP_430331.1 two component transcriptional regulator AE000516.2.gene3505. Protein 4e-34 42
Moth_1478 YP_430331.1 two component transcriptional regulator BAC0487 Protein 8e-23 42
Moth_1478 YP_430331.1 two component transcriptional regulator AF310956.2.orf0.gene Protein 8e-25 41
Moth_1478 YP_430331.1 two component transcriptional regulator U35369.1.gene1.p01 Protein 4e-24 41
Moth_1478 YP_430331.1 two component transcriptional regulator AE016830.1.gene2255. Protein 4e-24 41
Moth_1478 YP_430331.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 4e-30 41
Moth_1478 YP_430331.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-30 41
Moth_1478 YP_430331.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-30 41
Moth_1478 YP_430331.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-30 41
Moth_1478 YP_430331.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-30 41
Moth_1478 YP_430331.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-30 41
Moth_1478 YP_430331.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-30 41
Moth_1478 YP_430331.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-30 41
Moth_1478 YP_430331.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-30 41
Moth_1478 YP_430331.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Moth_1478 YP_430331.1 two component transcriptional regulator VFG1390 Protein 7e-47 50
Moth_1478 YP_430331.1 two component transcriptional regulator VFG0596 Protein 2e-35 48
Moth_1478 YP_430331.1 two component transcriptional regulator VFG1389 Protein 9e-35 44
Moth_1478 YP_430331.1 two component transcriptional regulator VFG0473 Protein 8e-26 42
Moth_1478 YP_430331.1 two component transcriptional regulator VFG1386 Protein 2e-39 41