Gene Information

Name : Rru_A3187 (Rru_A3187)
Accession : YP_428269.1
Strain : Rhodospirillum rubrum ATCC 11170
Genome accession: NC_007643
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3676464 - 3677153 bp
Length : 690 bp
Strand : +
Note : -

DNA sequence : 
TTGCGCGTGCTGTTGGTGGAAGACGAGCCAACCCTGGCCCTGACCCTGCGCCGCGTTCTTGAACGGGCGGGATTCGCCGT
CGATCTGGCCGATGATGGCGAGGAGGCTTTGTTCCTTGGGGAAACCGAACCCTTCGACGCCGTGGTCCTTGATCTTGGAT
TGCCCCGGCTTGACGGCATCGGCGTGCTGCGGCGCTGGCGCGCCGCCGGCATCGGCGTGCCGGTGCTGATCTTGACGGCG
CGCGGCGGCTGGCCGGAAAAGGTCGCCGGCTTCGAGGCCGGGGCCGATGACTACGTGACCAAACCCTTCGAGATGGAGGA
GGTGGTCTTGCGCCTGAAGGCGCTGATCCGCCGGGCGGCGGGCCATCCCTCGACCGAACTGGTGGCCGGACCCTTGCGCC
TGGATACCACTTCGGGGCGGGGCAGCGTCGAAGGCCGGCCGCTTGATCTGACCGCCCAGGAATACAAGATCCTGACCTAT
CTGCTGCTGCGCCAGGGGCAGACGGTAAGCCGCAGCGACATCGTCGACCACGTCTATGATCGCGACTCCGATCGCGATTC
CAACGTCATTGATGTGCTGGTCGGCCGCCTGCGCCGCAAGCTTGGCGCGCCGCTGATCCACACCGTGCGCGGTCTCGGCT
ATCGGCTGGAAGCCGAAAGCGCCCCCCCCGATCAAGGGGCGCTCCGCTGA

Protein sequence : 
MRVLLVEDEPTLALTLRRVLERAGFAVDLADDGEEALFLGETEPFDAVVLDLGLPRLDGIGVLRRWRAAGIGVPVLILTA
RGGWPEKVAGFEAGADDYVTKPFEMEEVVLRLKALIRRAAGHPSTELVAGPLRLDTTSGRGSVEGRPLDLTAQEYKILTY
LLLRQGQTVSRSDIVDHVYDRDSDRDSNVIDVLVGRLRRKLGAPLIHTVRGLGYRLEAESAPPDQGALR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 5e-31 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rru_A3187 YP_428269.1 two component transcriptional regulator NC_002516.2.879194.p Protein 4e-42 48
Rru_A3187 YP_428269.1 two component transcriptional regulator CP000647.1.gene1136. Protein 1e-38 46
Rru_A3187 YP_428269.1 two component transcriptional regulator BAC0530 Protein 1e-38 46
Rru_A3187 YP_428269.1 two component transcriptional regulator CP004022.1.gene1005. Protein 5e-40 45
Rru_A3187 YP_428269.1 two component transcriptional regulator CP001918.1.gene2526. Protein 2e-37 45
Rru_A3187 YP_428269.1 two component transcriptional regulator BAC0197 Protein 1e-34 44
Rru_A3187 YP_428269.1 two component transcriptional regulator CP000034.1.gene2022. Protein 3e-37 44
Rru_A3187 YP_428269.1 two component transcriptional regulator CP001138.1.gene1939. Protein 3e-38 44
Rru_A3187 YP_428269.1 two component transcriptional regulator BAC0083 Protein 9e-35 43
Rru_A3187 YP_428269.1 two component transcriptional regulator NC_002695.1.913289.p Protein 1e-36 43
Rru_A3187 YP_428269.1 two component transcriptional regulator BAC0638 Protein 1e-27 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rru_A3187 YP_428269.1 two component transcriptional regulator VFG0475 Protein 3e-38 44
Rru_A3187 YP_428269.1 two component transcriptional regulator VFG1389 Protein 6e-30 44
Rru_A3187 YP_428269.1 two component transcriptional regulator VFG1390 Protein 1e-32 41
Rru_A3187 YP_428269.1 two component transcriptional regulator VFG1386 Protein 6e-31 41