Gene Information

Name : amb0405 (amb0405)
Accession : YP_419768.1
Strain : Magnetospirillum magneticum AMB-1
Genome accession: NC_007626
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 437227 - 437568 bp
Length : 342 bp
Strand : -
Note : ISmag11,orf2; similar to IS66 family

DNA sequence :
GTGCCGCCGACATCGACGCGGGTGTGGTTGGCTGCCGGGCACACTGACATGCGCAAAGGTTTTGACGGGCTGGCTATGCT
GGTGCAGGCGAAGCTGTCTCGCGATCCCTTCGGCGGCCAGGTCTTCGTGTTCCGGGGGCGGCGGGGCGATCTGATCAAGG
TGCTGTGGTGGGACGGCCAAGGTCTTTGCCTATTTTCCAAGCGCCTGGAGAAGGGCGGCTTCGTCTGGCCGTCGCCGGCG
GACGGCATCGTCGGGCTGACTCCGGCGCAACTCGGCATGCTGCTGGAGGGGATCGACTGGAGGATGCCGATCCGCACCTG
GAAGCCGCAATCGGCGGGGTGA

Protein sequence :
MPPTSTRVWLAAGHTDMRKGFDGLAMLVQAKLSRDPFGGQVFVFRGRRGDLIKVLWWDGQGLCLFSKRLEKGGFVWPSPA
DGIVGLTPAQLGMLLEGIDWRMPIRTWKPQSAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 2e-23 67
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-23 67
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 6e-23 66
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-22 64
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-22 64
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 1e-21 63
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 5e-21 63
unnamed AAL99258.1 unknown Not tested LEE Protein 1e-21 63
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 1e-21 63
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-21 63
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 1e-21 63
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 1e-21 63
unnamed AAC31493.1 L0014 Not tested LEE Protein 1e-21 63
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 1e-21 63
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 5e-21 63
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 1e-21 62
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 1e-21 62
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-21 61
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 3e-22 60
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 3e-21 60
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 3e-21 60
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 6e-15 59
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 5e-21 58
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 4e-20 58
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 4e-20 58

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
amb0405 YP_419768.1 transposase VFG1665 Protein 2e-23 66
amb0405 YP_419768.1 transposase VFG1698 Protein 1e-22 64
amb0405 YP_419768.1 transposase VFG1709 Protein 4e-22 63
amb0405 YP_419768.1 transposase VFG0792 Protein 4e-22 63
amb0405 YP_419768.1 transposase VFG1052 Protein 9e-22 61
amb0405 YP_419768.1 transposase VFG1517 Protein 2e-15 59
amb0405 YP_419768.1 transposase VFG1737 Protein 1e-21 58