Gene Information

Name : amb3319 (amb3319)
Accession : YP_422682.1
Strain : Magnetospirillum magneticum AMB-1
Genome accession: NC_007626
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 3601201 - 3601542 bp
Length : 342 bp
Strand : +
Note : ISmag11,orf2; similar to IS66 family

DNA sequence :
GTGCCGCCGACGTCGACGCGGGTGTGGTTGGCTTCCGGGCACACCGACATGCGCAAAGGTTTTGACGGGCTGGCGATGCT
GGTGCAGGCGAAGCTGTCTCGCGATCCCTTCGGCGGCCAGGTCTTCGTGTTCCGGGGGCGGCGGGGCGATCTGATCAAGG
TGTTGTGGTGGGACGGCCAAGGTCTTTGCCTATTTTCCAAGCGTCTGGAGAAGGGCCGCTTCGTCTGGCCGTCGCCGGCG
GACGGCATCGTCGGGCTGACTCCGGCGCAACTCGGCATGCTGCTGGAGGGGATCGACTGGAGGATGCCGATCCGCACCTG
GAAGCCGCAATCGGCGGGGTGA

Protein sequence :
MPPTSTRVWLASGHTDMRKGFDGLAMLVQAKLSRDPFGGQVFVFRGRRGDLIKVLWWDGQGLCLFSKRLEKGRFVWPSPA
DGIVGLTPAQLGMLLEGIDWRMPIRTWKPQSAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 4e-24 67
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 4e-24 67
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 1e-23 66
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 6e-23 64
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 6e-23 64
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-22 63
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-22 63
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 8e-22 63
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 8e-22 63
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-22 63
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-22 63
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-22 63
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-22 63
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-22 63
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-22 63
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 2e-22 62
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 2e-22 62
unnamed AAL08461.1 unknown Not tested SRL Protein 3e-22 61
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 5e-23 60
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 8e-16 59
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 2e-21 59
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 2e-21 59
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 3e-20 57
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 3e-20 57
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-21 57

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
amb3319 YP_422682.1 transposase VFG1665 Protein 4e-24 66
amb3319 YP_422682.1 transposase VFG1698 Protein 2e-23 64
amb3319 YP_422682.1 transposase VFG1709 Protein 6e-23 63
amb3319 YP_422682.1 transposase VFG0792 Protein 6e-23 63
amb3319 YP_422682.1 transposase VFG1052 Protein 1e-22 61
amb3319 YP_422682.1 transposase VFG1517 Protein 3e-16 59
amb3319 YP_422682.1 transposase VFG1737 Protein 1e-21 57