Gene Information

Name : set7 (SAB0379)
Accession : YP_415880.1
Strain : Staphylococcus aureus RF122
Genome accession: NC_007622
Putative virulence/resistance : Virulence
Product : superantigen-like protein 5
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 415089 - 415739 bp
Length : 651 bp
Strand : +
Note : SSL5, SET3, SET10; bind P-selectin glycoprotein ligand-1 and inhibit P-selectin-mediated neutrophil rolling along the endothelium; these proteins share structural homology to known superantigens but do not exhibit any of the properties expected such as hi

DNA sequence : 
ATGAAAATGACAGCAATTGCGAAAGCAAGTTTAGCATTAGGTATTTTAGCAACAGGAACAATAACATCAACGCATCAAAC
TGTAAATGCGAGTGAACATGAAGCAAAATATGAAAATGTGACAAAAGATATTTTTGACTTAAGAGATTACTATAGTGGCG
CAAGTAAGGAACTTAAAAATGTTACTGGTTATCGTTATAGCAAAGGTGGTAAGCATTACCTTATCTTTGATAAACATCAA
AAGTTCACTAGAATACAAATTTTTGGCAAAGATATAGAAAGACTTAAAACACGTAAAAATCCAGGTTTAGATATATTTGT
AGTTAAAGAAGCAGAAAATCGCAACGGCACAGTGTTTTCATATGGTGGTGTCACTAAGAAAAATCAAGGTGCTTACTATG
ATTACTTAAACGCACCTAAATTCGTTATTAAAAAAGAAGTAGACGCAGGTGTTTATACGCATGTTAAAAGACACTACATT
TATAAAGAAGAGATTTCACTTAAAGAACTCGACTTTAAACTGAGACAGTATTTAATTCAAAATTTTGATCTGTATAAAAA
GTTTCCTAAAGATAGTAAGATAAAAGTGATAATGAAAGATGGTGGCTATTATACGTTTGAACTTAATAAAAATTACAAAC
AAATCGCATGA

Protein sequence : 
MKMTAIAKASLALGILATGTITSTHQTVNASEHEAKYENVTKDIFDLRDYYSGASKELKNVTGYRYSKGGKHYLIFDKHQ
KFTRIQIFGKDIERLKTRKNPGLDIFVVKEAENRNGTVFSYGGVTKKNQGAYYDYLNAPKFVIKKEVDAGVYTHVKRHYI
YKEEISLKELDFKLRQYLIQNFDLYKKFPKDSKIKVIMKDGGYYTFELNKNYKQIA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SAS0388 YP_042513.1 superantigen-like protein 5 Virulence vSa¥á Protein 3e-86 91
set20 NP_645203.1 superantigen-like protein 5 Virulence vSa¥á Protein 3e-86 91
set3 YP_039879.1 superantigen-like protein 5 Virulence vSa¥á Protein 9e-87 91
SAKOR_00409 YP_008490593.1 Exotoxin Virulence vSa¥á Protein 3e-86 91
set10 NP_373636.1 superantigen-like protein 5 Virulence vSa¥á Protein 3e-85 90
set5nm YP_001331426.1 superantigen-like protein 5 Virulence vSa¥á Protein 7e-85 90
SAUSA300_0399 YP_493113.1 superantigen-like protein 5 Virulence vSa¥á Protein 7e-85 90
set10 NP_370949.1 superantigen-like protein 5 Virulence vSa¥á Protein 3e-85 90
SAMSHR1132_03750 YP_005324897.1 exotoxin 3 Virulence vSa¥á Protein 4e-79 80
SAS0396 YP_042522.1 superantigen-like protein Virulence vSa¥á Protein 5e-36 48
set26 NP_645211.1 superantigen-like protein Virulence vSa¥á Protein 5e-36 48
set15 NP_370957.1 superantigen-like protein Virulence vSa¥á Protein 8e-35 46
set15 NP_373644.1 superantigen-like protein Virulence vSa¥á Protein 8e-35 46
SACOL0478 YP_185368.1 superantigen-like protein Virulence vSa¥á Protein 6e-30 46
set11nm YP_001331434.1 superantigen-like protein Virulence vSa¥á Protein 6e-30 46
SAUSA300_0407 YP_493121.1 superantigen-like protein Virulence vSa¥á Protein 6e-30 46
SAR0435 YP_039886.1 superantigen-like protein Virulence vSa¥á Protein 2e-34 46
SAKOR_00417 YP_008490601.1 Exotoxin Not tested vSa¥á Protein 2e-32 46
SAMSHR1132_03810 YP_005324902.1 exotoxin Virulence vSa¥á Protein 2e-31 45
SACOL0468 YP_185358.1 superantigen-like protein Virulence vSa¥á Protein 1e-33 43
SAR0422 YP_039874.1 superantigen-like protein Virulence vSa¥á Protein 3e-30 43
set1nm YP_001331422.1 superantigen-like protein Virulence vSa¥á Protein 1e-33 43
SAUSA300_0395 YP_493109.1 superantigen-like protein Virulence vSa¥á Protein 1e-33 43
SAS0384 YP_042509.1 superantigen-like protein Virulence vSa¥á Protein 2e-31 43
set16 NP_645199.1 superantigen-like protein Virulence vSa¥á Protein 2e-31 43
SAMSHR1132_03720 YP_005324894.1 exotoxin Virulence vSa¥á Protein 5e-32 43
SAKOR_00404 YP_008490588.1 Exotoxin Virulence vSa¥á Protein 6e-34 43
set6 NP_370946.1 superantigen-like protein Virulence vSa¥á Protein 2e-32 41
set6 NP_373632.1 superantigen-like protein Virulence vSa¥á Protein 2e-32 41
set8nm YP_001331429.2 superantigen-like protein Virulence vSa¥á Protein 5e-25 41
SAUSA300_0402 YP_493116.1 superantigen-like protein Virulence vSa¥á Protein 5e-25 41
SAS0391 YP_042516.2 superantigen-like protein Virulence vSa¥á Protein 3e-25 41
set23 NP_645206.1 superantigen-like protein Virulence vSa¥á Protein 3e-25 41
set12 NP_370951.1 superantigen-like protein Virulence vSa¥á Protein 2e-25 41
set12 NP_373638.1 superantigen-like protein Virulence vSa¥á Protein 2e-25 41
SAKOR_00411 YP_008490595.1 Exotoxin Virulence vSa¥á Protein 3e-25 41