Gene Information

Name : set11 (SAB0376)
Accession : YP_415877.1
Strain : Staphylococcus aureus RF122
Genome accession: NC_007622
Putative virulence/resistance : Virulence
Product : superantigen-like protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 411724 - 412404 bp
Length : 681 bp
Strand : +
Note : these proteins share structural homology to known superantigen proteins but do not exhibit any of the properties expected such as histocompatibility complex class II binding or broad T-cell activation

DNA sequence : 
ATGAAATTTAAAGCGATAGCAAAAGCAAGTTTAGCATTGGGAATGTTAGCAACAGGTGTAATTACATCGAATGTACAATC
AGTACAAGCGAAAACAGAAGTTAAACAACAAAGTGAATCAGAGTTGAAACACTATTATAATAAACCATTTTTCGAGCGTA
AAAATGTGACTGGATATAAATATACTGAAAATGGTAAAGATTATATGGAAGTCGCAACAGATCATCAGTATTATCAAATA
TCGTTACTAGGTCCGGATAAAGATAAATTTAAAGAAGGAAATAATCCAGGTCTAGATATATTTGTCGTTAGGGAAGGTGA
CAGTAGGCAAGCTGCGAATTACTCAATTGGTGGCGTAACAAAAACAAACAGTCAACCTTTTATTGACTATATACACACAC
CAATCCTTGAAATCAAGAAAGGTAAAGAAGAACCACAAAGTAGTCTATACCAAATTTATAAAGAAGACATATCACTAAAA
GAACTTGATTTTAAATTAAGAAAGCAATTAATTAGTCAAAGTGGCTTGTATTCAAATGGTCTTAAACAAGGTCAAATTAC
AATTACAATGAAAGATGGCAAATCACATACTATCGATTTAAGTCAAAAACTTGAAAAAGAACGTATGGGTGAGTCAATCG
ACGGCAGAGAAATACAAAAAATTCTAGTAGAAATTAAATAA

Protein sequence : 
MKFKAIAKASLALGMLATGVITSNVQSVQAKTEVKQQSESELKHYYNKPFFERKNVTGYKYTENGKDYMEVATDHQYYQI
SLLGPDKDKFKEGNNPGLDIFVVREGDSRQAANYSIGGVTKTNSQPFIDYIHTPILEIKKGKEEPQSSLYQIYKEDISLK
ELDFKLRKQLISQSGLYSNGLKQGQITITMKDGKSHTIDLSQKLEKERMGESIDGREIQKILVEIK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
set6 NP_370946.1 superantigen-like protein Virulence vSa¥á Protein 8e-92 87
set6 NP_373632.1 superantigen-like protein Virulence vSa¥á Protein 8e-92 87
SAS0384 YP_042509.1 superantigen-like protein Virulence vSa¥á Protein 8e-79 79
set16 NP_645199.1 superantigen-like protein Virulence vSa¥á Protein 8e-79 79
SAKOR_00404 YP_008490588.1 Exotoxin Virulence vSa¥á Protein 2e-81 77
SACOL0468 YP_185358.1 superantigen-like protein Virulence vSa¥á Protein 1e-79 76
set1nm YP_001331422.1 superantigen-like protein Virulence vSa¥á Protein 1e-79 76
SAUSA300_0395 YP_493109.1 superantigen-like protein Virulence vSa¥á Protein 1e-79 76
SAR0422 YP_039874.1 superantigen-like protein Virulence vSa¥á Protein 6e-76 75
SAMSHR1132_03720 YP_005324894.1 exotoxin Virulence vSa¥á Protein 1e-68 68
SAKOR_00417 YP_008490601.1 Exotoxin Not tested vSa¥á Protein 2e-44 48
SACOL0478 YP_185368.1 superantigen-like protein Virulence vSa¥á Protein 3e-41 48
set11nm YP_001331434.1 superantigen-like protein Virulence vSa¥á Protein 3e-41 48
SAUSA300_0407 YP_493121.1 superantigen-like protein Virulence vSa¥á Protein 3e-41 48
SAR0435 YP_039886.1 superantigen-like protein Virulence vSa¥á Protein 2e-43 47
set5nm YP_001331426.1 superantigen-like protein 5 Virulence vSa¥á Protein 1e-43 46
SAUSA300_0399 YP_493113.1 superantigen-like protein 5 Virulence vSa¥á Protein 1e-43 46
set3 YP_039879.1 superantigen-like protein 5 Virulence vSa¥á Protein 2e-43 46
SAS0388 YP_042513.1 superantigen-like protein 5 Virulence vSa¥á Protein 2e-43 46
set20 NP_645203.1 superantigen-like protein 5 Virulence vSa¥á Protein 2e-43 46
set15 NP_370957.1 superantigen-like protein Virulence vSa¥á Protein 3e-42 45
set15 NP_373644.1 superantigen-like protein Virulence vSa¥á Protein 3e-42 45
SAS0396 YP_042522.1 superantigen-like protein Virulence vSa¥á Protein 1e-42 45
set26 NP_645211.1 superantigen-like protein Virulence vSa¥á Protein 1e-42 45
set10 NP_370949.1 superantigen-like protein 5 Virulence vSa¥á Protein 2e-43 45
set10 NP_373636.1 superantigen-like protein 5 Virulence vSa¥á Protein 2e-43 45
SAKOR_00409 YP_008490593.1 Exotoxin Virulence vSa¥á Protein 5e-44 45
SAMSHR1132_03750 YP_005324897.1 exotoxin 3 Virulence vSa¥á Protein 9e-41 44
SAMSHR1132_03810 YP_005324902.1 exotoxin Virulence vSa¥á Protein 2e-34 43
SAS0389 YP_042514.1 superantigen-like protein Virulence vSa¥á Protein 1e-31 43
set21 NP_645204.1 superantigen-like protein Virulence vSa¥á Protein 1e-31 43
SAS0390 YP_042515.1 superantigen-like protein 7 Virulence vSa¥á Protein 5e-30 42
set22 NP_645205.1 superantigen-like protein 7 Virulence vSa¥á Protein 5e-30 42
set1 YP_039880.1 superantigen-like protein 7 Virulence vSa¥á Protein 1e-28 42
SAKOR_00410 YP_008490594.1 Exotoxin Virulence vSa¥á Protein 7e-33 42
set7nm YP_001331428.1 superantigen-like protein 7 Virulence vSa¥á Protein 8e-32 42
SAUSA300_0401 YP_493115.1 superantigen-like protein 7 Virulence vSa¥á Protein 8e-32 42
set6nm YP_001331427.1 superantigen-like protein Virulence vSa¥á Protein 4e-33 42
SAUSA300_0400 YP_493114.1 superantigen-like protein Virulence vSa¥á Protein 4e-33 42
SAMSHR1132_03760 YP_005324898.1 exotoxin 1 Virulence vSa¥á Protein 2e-28 41
SAR0425 YP_039877.1 superantigen-like protein Not tested vSa¥á Protein 4e-27 41