Gene Information

Name : SAB1299 (SAB1299)
Accession : YP_416775.1
Strain : Staphylococcus aureus RF122
Genome accession: NC_007622
Putative virulence/resistance : Unknown
Product : transposase for IS-like element
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3316
EC number : -
Position : 1421380 - 1422054 bp
Length : 675 bp
Strand : +
Note : -

DNA sequence :
ATGAACTATTTCAGATATAAACAATTTAACAAGGATGTTATCACTGTAGCCGTTGGCTACTATCTAAGATATGCATTGAG
TTATCGTGATATATCTGAAATATTAAGGGAACGTGGTGTAAACGTTCATCATTCAACGGTCTACCGTTGGGTTCAAGAAT
ATGCCCCAATTTTATATCAAATTTGGAAGAAAAAGCATAAAAAAGCTTATTACAAATGGCGTATTGATGAGACGTACATC
AAAATAAAAGCAAAATGGAACTATTTATATCGTGCCATTGATGCAGAGGGACATTCATTAGATATTTGGTTGCGTAAGCA
ACGAGATAATCATTCAGCATATGCGTTTATCAAACGTCTTATTAAACAATTCGGTAAACCTCAAATGATAATTACAGATC
AAGCACCTTCAACGAAGGTTGCAATGACTAAAATAGTGAAAGTGTTTAAGCTGAACCCTAACTGTCATTGCACATCTAAA
TATCTCAATAACCTCATTGAACAAGATCATCGTCATATCAAATCAAGGAAAATAAGTTATCAAAGTATCAATACGGCAAA
GAATACGATCAAAGGCATTGAATGTATTTATGGACTATATAAAAAGAACCGCAGATCTCTTCAGATCTACAGGTTTTCGC
CATGCCGTGTAATTAGCATCATGCTAGCTAGTTAA

Protein sequence :
MNYFRYKQFNKDVITVAVGYYLRYALSYRDISEILRERGVNVHHSTVYRWVQEYAPILYQIWKKKHKKAYYKWRIDETYI
KIKAKWNYLYRAIDAEGHSLDIWLRKQRDNHSAYAFIKRLIKQFGKPQMIITDQAPSTKVAMTKIVKVFKLNPNCHCTSK
YLNNLIEQDHRHIKSRKISYQSINTAKNTIKGIECIYGLYKKNRRSLQIYRFSPCRVISIMLAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed BAA82228.1 transposase for insertion sequence-like element IS431mec Not tested Type-II SCCmec Protein 6e-91 92
unnamed BAB47638.1 putative transposase of IS431 Not tested Type-III SCCmec Protein 2e-90 92
SERP2526 YP_190067.1 IS431mec-like transposase Not tested Type-II SCCmec Protein 9e-91 92
SAR0034 YP_039511.1 transposase Not tested Type-II SCCmec Protein 9e-91 92
unnamed BAA82238.1 transposase for insertion sequence-like element IS431mec Not tested Type-II SCCmec Protein 6e-91 92
unnamed BAB47648.1 putative transposase of IS431 Not tested Type-III SCCmec Protein 2e-90 92
tnp YP_252002.1 transposase for IS431mec Not tested SCCmec Protein 9e-91 92
SAMSHR1132_00280 YP_005324552.1 putative transposase Not tested Type-IIIinv SCCmec Protein 9e-91 92
SERP1579 YP_189144.1 IS431mec-like transposase Not tested ¥ÕSP¥â Protein 2e-90 92
tnp YP_252008.1 transposase for IS431mec Not tested SCCmec Protein 9e-91 92
MW0027 NP_644842.1 transposase for IS-like element Not tested Type-IV SCCmec Protein 9e-91 92
tnp BAA86652.1 transposase Not tested Type-I SCCmec Protein 6e-91 92
tnp NP_370551.1 transposase for IS-like element Not tested Type-II SCCmec Protein 9e-91 92
SAPIG0054 YP_005732864.1 transposase Not tested Type-V SCCmec Protein 2e-90 92
unnamed BAB47631.1 putative transposase of IS431 Not tested Type-III SCCmec Protein 6e-91 92
tnp NP_370560.2 transposase for IS-like element Not tested Type-II SCCmec Protein 9e-91 92
SE0090 NP_763645.1 transposase for IS-like element Not tested SCCpbp4 Protein 2e-90 92
tnp BAB72117.1 transposase of IS431mec Not tested Type-IVa SCCmec Protein 6e-91 92
SA0026 NP_373265.1 transposase for IS-like element Not tested Type-II SCCmec Protein 9e-91 92
SE0079 NP_763634.1 transposase for IS-like element Not tested SCCpbp4 Protein 2e-90 92
tnp BAB72136.1 transposase of IS431mec Not tested Type-IVb SCCmec Protein 6e-91 92
SA0034 NP_373274.1 transposase for IS-like element Not tested Type-II SCCmec Protein 9e-91 92
SACOL0028 YP_184939.1 IS431mec, transposase Not tested Type-I SCCmec Protein 9e-91 92
tnp BAC67570.1 transposase of IS431mec Not tested Type-IVc SCCmec Protein 6e-91 92
SAUSA300_0028 YP_492748.1 putative transposase Not tested Type-IV SCCmec Protein 9e-91 92
SAR0027 YP_039504.1 transposase Not tested Type-II SCCmec Protein 9e-91 92
SAPIG0038 YP_005732848.1 transposase Not tested Type-V SCCmec Protein 7e-90 91
SE0071 NP_763626.1 transposase for IS-like element Not tested SCCpbp4 Protein 4e-90 91
tnp BAD24823.1 transposase for IS431 Not tested Type-V SCCmec Protein 1e-90 91
unnamed ACL99852.1 transposase Not tested Type-V SCCmec Protein 5e-90 91
tnp BAG06195.1 transposase for IS431 Not tested Type-VII SCCmec Protein 5e-90 91
unnamed BAB47635.1 putative transposase of IS431 Not tested Type-III SCCmec Protein 4e-90 91
tnp YP_252034.1 transposase for IS431mec Not tested SCCmec Protein 1e-89 91
unnamed BAD24828.1 transposase for IS431 Not tested Type-V SCCmec Protein 3e-90 91
tnp YP_251940.1 transposase for IS431mec Not tested SCCmec Protein 1e-88 90
unnamed AAP55235.1 transposase Not tested SaPIbov2 Protein 1e-89 89
tnp YP_254240.1 transposase for IS431mec Not tested ¥ðSh1 Protein 2e-86 88
ef0041 AAM75240.1 EF0034 Not tested Not named Protein 6e-57 59
ef0039 AAM75245.1 EF0039 Not tested Not named Protein 2e-48 55
tnpA6100 ACN81001.1 transposase Not tested AbaR5 Protein 2e-27 42
tnpA6100 ACN62081.1 TnpA6100 Not tested SGI1 Protein 1e-27 42
tnpA6100 AGK07076.1 IS6100 transposase Not tested SGI1 Protein 3e-28 42
tnpA6100 AGF35032.1 IS6100 transposase Not tested SGI1 Protein 1e-27 42
tnpA6100 AGF35067.1 IS6100 transposase Not tested SGI1 Protein 1e-27 42
tnpA6100 AGK06937.1 IS6100 transposase Not tested SGI1 Protein 1e-27 42
tnpA6100 AGK06983.1 IS6100 transposase Not tested SGI1 Protein 1e-27 42
CDBH8_0916 YP_005160008.1 transposase-like protein Not tested Not named Protein 2e-27 42
tnpA6100 AGK07042.1 IS6100 transposase Not tested SGI1 Protein 1e-27 42
tnpA6100 AGK07113.1 IS6100 transposase Not tested SGI1 Protein 1e-27 42
tnpA AAG03007.1 transposase Not tested SGI1 Protein 1e-27 42
tnp6100 ACX47960.1 tnp6100 Not tested SGI1 Protein 3e-28 42
tnp6100 ACS32049.1 Tnp6100 Not tested SGI2 Protein 1e-27 42
tnpA6100 AGK07018.1 IS6100 transposase Not tested SGI1 Protein 3e-28 42
tnpA6100 AGF34993.1 IS6100 transposase Not tested SGI1 Protein 1e-27 42
tnpA CAJ77056.1 Transposase Not tested AbaR1 Protein 1e-27 42