Gene Information

Name : arsR (SBO_3499)
Accession : YP_409812.1
Strain : Shigella boydii Sb227
Genome accession: NC_007613
Putative virulence/resistance : Resistance
Product : DNA-binding transcriptional repressor ArsR
Function : -
COG functional category : K : Transcription
COG ID : COG0640
EC number : -
Position : 3493487 - 3493840 bp
Length : 354 bp
Strand : +
Note : regulates the expression of of the arsRBC involved in resistance to arsenic

DNA sequence :
ATGTCATTTCTGTTACCCATCCAATTGTTCAAAATTCTTGCTGATGAAACCCGTCTGGGCATCGTTTTACTGCTCAGCGA
ACTGGGAGAGTTATGCGTCTGCGATCTCTGCACTGCTCTCGACCAGTCGCAGCCCAAGATCTCCCGCCACCTGGCATTGC
TGCGTGAAAGCGGGCTATTGCTGGACCGCAAGCAAGGTAAATGGGTTCATTACCGCTTATCGCCGCATATTCCAGCATGG
GCGGCGAAAATAATTGATGAAGCCTGGCGATGTGAACAGGAAAAGATTCAGGCAATTGTCCGCAACCTGGCTCGACAAAA
CTGTTCCGCAGACAGTAAGAACATTTGCAGTTAA

Protein sequence :
MSFLLPIQLFKILADETRLGIVLLLSELGELCVCDLCTALDQSQPKISRHLALLRESGLLLDRKQGKWVHYRLSPHIPAW
AAKIIDEAWRCEQEKIQAIVRNLARQNCSADSKNICS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsR2 YP_001007630.1 DNA-binding transcriptional repressor ArsR Not tested YAPI Protein 2e-38 73
arsR AFC76435.1 ArsR Not tested AbaR5 Protein 4e-19 49
arsR CAJ77018.1 arsenite inducible repressor Not tested AbaR1 Protein 3e-19 49

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
arsR YP_409812.1 DNA-binding transcriptional repressor ArsR BAC0594 Protein 1e-49 99
arsR YP_409812.1 DNA-binding transcriptional repressor ArsR BAC0589 Protein 1e-39 76
arsR YP_409812.1 DNA-binding transcriptional repressor ArsR BAC0591 Protein 1e-39 73
arsR YP_409812.1 DNA-binding transcriptional repressor ArsR BAC0588 Protein 3e-30 71