Gene Information

Name : SDY_4481 (SDY_4481)
Accession : YP_405848.1
Strain : Shigella dysenteriae Sd197
Genome accession: NC_007606
Putative virulence/resistance : Unknown
Product : ISSfl4 ORF2
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 4198920 - 4199255 bp
Length : 336 bp
Strand : +
Note : Code: L; COG: COG3436

DNA sequence :
ATGATAACGCTGCCGACCGGTACCAAAATCTGGATCATCGCTGGCATCACAGATATGCGTTGTGGCTTCAATGGCCTGGC
TTCGAAGGTGCAGAACACGCTGAAAGATGACCCGTTCTCCGGGCATATCTTCGTCTTCCGGGGCCGCAGTGCAAAACTGT
GGGCCGATCGTGACGGGTTATGCCTGTTCGCCAAACGCCTGGAACGGGGCCGCTTCGTCTGGCCGGTAACCCGGGAAGGG
AAAGTGCACCTGACGCCAGCTCAGTTATCCATGCTACTGGAGGGGATCGCGTGGCAACATCCCAAACGGACAGAACGGCC
TGGCATCCGGATATAA

Protein sequence :
MITLPTGTKIWIIAGITDMRCGFNGLASKVQNTLKDDPFSGHIFVFRGRSAKLWADRDGLCLFAKRLERGRFVWPVTREG
KVHLTPAQLSMLLEGIAWQHPKRTERPGIRI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 2e-46 94
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 2e-46 94
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 3e-42 80
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 8e-42 80
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 3e-42 80
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 6e-35 72
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 6e-35 72
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-34 71
unnamed AAL08461.1 unknown Not tested SRL Protein 3e-34 71
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-34 71
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-34 71
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-34 71
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-34 71
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-34 71
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-34 71
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-34 71
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-33 71
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-33 71
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 1e-25 69
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 3e-29 61
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 2e-30 58
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 2e-30 58
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 1e-31 58
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 1e-31 58
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-31 57

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SDY_4481 YP_405848.1 ISSfl4 ORF2 VFG1665 Protein 3e-42 80
SDY_4481 YP_405848.1 ISSfl4 ORF2 VFG1698 Protein 2e-35 72
SDY_4481 YP_405848.1 ISSfl4 ORF2 VFG0792 Protein 7e-35 71
SDY_4481 YP_405848.1 ISSfl4 ORF2 VFG1052 Protein 1e-34 71
SDY_4481 YP_405848.1 ISSfl4 ORF2 VFG1709 Protein 7e-35 71
SDY_4481 YP_405848.1 ISSfl4 ORF2 VFG1517 Protein 5e-26 69
SDY_4481 YP_405848.1 ISSfl4 ORF2 VFG1737 Protein 5e-32 57