Name : marA (SDY_1596) Accession : YP_403215.2 Strain : Shigella dysenteriae Sd197 Genome accession: NC_007606 Putative virulence/resistance : Resistance Product : DNA-binding transcriptional activator MarA Function : - COG functional category : K : Transcription COG ID : COG2207 EC number : - Position : 1459540 - 1459923 bp Length : 384 bp Strand : - Note : multiple antibiotic resistance; transcriptional activator of defense systems; transcriptional activator of genes involved in the multiple antibiotic resistance (Mar) phenotype; also activates sodA, zwf and micF DNA sequence : ATGTCCAAACGCAATACTGACGCTATTACCATTCATAGCATTTTGGACTGGATCGAGGACAACCTGGAATCGCCACTGTC ACTGGAGAAAGTGTCAGAACGTTCGGGTTACTCCAAATGGCACCTGCAACGGATGTTTAAAAAAGAAACCGGTCATTCAT TAGGCCAATACATCCGCAGCCGTAAGATGACGGAAATCGCGCAAAAGCTGAAGGAAAGTAACGAGCCAATACTCTATCTG GCAGAACGATATGGCTTCGAGTCGCAACAAACTCTGACCCGAACCTTCAAAAATTACTTTGATGTCCCGCCACATAAATA CCGGATGACCAATATGCAGGGCGAATCGCGCTTTTTACATCCATTAAATCATTACAACAGCTAG Protein sequence : MSKRNTDAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYL AERYGFESQQTLTRTFKNYFDVPPHKYRMTNMQGESRFLHPLNHYNS |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
tetD | AEA34665.1 | tetracycline resistance protein D | Not tested | Not named | Protein | 3e-21 | 44 |
tetD | AAL08447.1 | putative transcriptional regulator TetD | Not tested | SRL | Protein | 3e-21 | 44 |
soxS | YP_219131.1 | DNA-binding transcriptional regulator SoxS | Not tested | SPI-4 | Protein | 1e-19 | 42 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
marA | YP_403215.2 | DNA-binding transcriptional activator MarA | CP000034.1.gene1596. | Protein | 8e-57 | 100 |
marA | YP_403215.2 | DNA-binding transcriptional activator MarA | BAC0560 | Protein | 1e-56 | 99 |
marA | YP_403215.2 | DNA-binding transcriptional activator MarA | NC_002695.1.917339.p | Protein | 1e-56 | 99 |
marA | YP_403215.2 | DNA-binding transcriptional activator MarA | CP001138.1.gene1637. | Protein | 4e-53 | 96 |
marA | YP_403215.2 | DNA-binding transcriptional activator MarA | CP001918.1.gene2033. | Protein | 3e-52 | 92 |
marA | YP_403215.2 | DNA-binding transcriptional activator MarA | CP000647.1.gene1624. | Protein | 3e-52 | 92 |
marA | YP_403215.2 | DNA-binding transcriptional activator MarA | NC_010558.1.6276025. | Protein | 2e-21 | 44 |
marA | YP_403215.2 | DNA-binding transcriptional activator MarA | CP001138.1.gene612.p | Protein | 7e-23 | 43 |
marA | YP_403215.2 | DNA-binding transcriptional activator MarA | CP001138.1.gene4488. | Protein | 4e-20 | 42 |
marA | YP_403215.2 | DNA-binding transcriptional activator MarA | NC_002695.1.914293.p | Protein | 1e-19 | 42 |
marA | YP_403215.2 | DNA-binding transcriptional activator MarA | CP000034.1.gene4505. | Protein | 2e-19 | 42 |
marA | YP_403215.2 | DNA-binding transcriptional activator MarA | BAC0371 | Protein | 1e-19 | 42 |
marA | YP_403215.2 | DNA-binding transcriptional activator MarA | CP001918.1.gene327.p | Protein | 3e-20 | 42 |
marA | YP_403215.2 | DNA-binding transcriptional activator MarA | CP000647.1.gene4499. | Protein | 7e-20 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
marA | YP_403215.2 | DNA-binding transcriptional activator MarA | VFG1038 | Protein | 1e-21 | 44 |
marA | YP_403215.2 | DNA-binding transcriptional activator MarA | VFG0585 | Protein | 4e-20 | 42 |