Gene Information

Name : marA (SDY_1596)
Accession : YP_403215.2
Strain : Shigella dysenteriae Sd197
Genome accession: NC_007606
Putative virulence/resistance : Resistance
Product : DNA-binding transcriptional activator MarA
Function : -
COG functional category : K : Transcription
COG ID : COG2207
EC number : -
Position : 1459540 - 1459923 bp
Length : 384 bp
Strand : -
Note : multiple antibiotic resistance; transcriptional activator of defense systems; transcriptional activator of genes involved in the multiple antibiotic resistance (Mar) phenotype; also activates sodA, zwf and micF

DNA sequence :
ATGTCCAAACGCAATACTGACGCTATTACCATTCATAGCATTTTGGACTGGATCGAGGACAACCTGGAATCGCCACTGTC
ACTGGAGAAAGTGTCAGAACGTTCGGGTTACTCCAAATGGCACCTGCAACGGATGTTTAAAAAAGAAACCGGTCATTCAT
TAGGCCAATACATCCGCAGCCGTAAGATGACGGAAATCGCGCAAAAGCTGAAGGAAAGTAACGAGCCAATACTCTATCTG
GCAGAACGATATGGCTTCGAGTCGCAACAAACTCTGACCCGAACCTTCAAAAATTACTTTGATGTCCCGCCACATAAATA
CCGGATGACCAATATGCAGGGCGAATCGCGCTTTTTACATCCATTAAATCATTACAACAGCTAG

Protein sequence :
MSKRNTDAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYL
AERYGFESQQTLTRTFKNYFDVPPHKYRMTNMQGESRFLHPLNHYNS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 3e-21 44
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 3e-21 44
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 1e-19 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
marA YP_403215.2 DNA-binding transcriptional activator MarA CP000034.1.gene1596. Protein 8e-57 100
marA YP_403215.2 DNA-binding transcriptional activator MarA BAC0560 Protein 1e-56 99
marA YP_403215.2 DNA-binding transcriptional activator MarA NC_002695.1.917339.p Protein 1e-56 99
marA YP_403215.2 DNA-binding transcriptional activator MarA CP001138.1.gene1637. Protein 4e-53 96
marA YP_403215.2 DNA-binding transcriptional activator MarA CP001918.1.gene2033. Protein 3e-52 92
marA YP_403215.2 DNA-binding transcriptional activator MarA CP000647.1.gene1624. Protein 3e-52 92
marA YP_403215.2 DNA-binding transcriptional activator MarA NC_010558.1.6276025. Protein 2e-21 44
marA YP_403215.2 DNA-binding transcriptional activator MarA CP001138.1.gene612.p Protein 7e-23 43
marA YP_403215.2 DNA-binding transcriptional activator MarA CP001138.1.gene4488. Protein 4e-20 42
marA YP_403215.2 DNA-binding transcriptional activator MarA NC_002695.1.914293.p Protein 1e-19 42
marA YP_403215.2 DNA-binding transcriptional activator MarA CP000034.1.gene4505. Protein 2e-19 42
marA YP_403215.2 DNA-binding transcriptional activator MarA BAC0371 Protein 1e-19 42
marA YP_403215.2 DNA-binding transcriptional activator MarA CP001918.1.gene327.p Protein 3e-20 42
marA YP_403215.2 DNA-binding transcriptional activator MarA CP000647.1.gene4499. Protein 7e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
marA YP_403215.2 DNA-binding transcriptional activator MarA VFG1038 Protein 1e-21 44
marA YP_403215.2 DNA-binding transcriptional activator MarA VFG0585 Protein 4e-20 42