Gene Information

Name : Dde_2387 (Dde_2387)
Accession : YP_388879.1
Strain : Desulfovibrio alaskensis G20
Genome accession: NC_007519
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2411516 - 2412205 bp
Length : 690 bp
Strand : -
Note : KEGG: dvm:DvMF_0882 two component transcriptional regulator, winged helix family; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver re

DNA sequence :
ATGGCGAAGGATCGCTTGCTCGTCGTCGAGGACGACGGGGATATCCTCCAGCTGCTCACATTTACGCTGGAGTCCGCAGG
CTTCGAGGTGTTTTCCGCCATGGACGGAAAAACCGGACTGGAGCTGGCGATGCGTGAGAAACCGGATCTTGTGGTGCTGG
ACCTGATGTTGCCCGGCATGAGCGGACTTGATGTCTGCAAGGATCTGAAAAGAATGCCTGAAACGCAGGAAACGCCCGTT
ATTATGCTGACGGCGCGGGGCGAAGAGGTAGACCGCATCGTAGGGCTGGAGCTGGGCGCTGATGATTATGTCGTCAAGCC
GTTCAGTCCCCGCGAGCTTGTGCTGCGCATCAAGGCGGTGCTTAAGCGCGGGGCGCCGTTTACCGAGCAGGAAGAACGGA
CCCGCTGGCGGGTGAACGGGCTGAGTCTGGATACCGAAGCCCACCGGGTGGAGATTGACGGCGATGAGGTGACCCTGACC
GCCACCGAGTTCAAGCTGCTTTTCGAGCTGGTACGCAACAGGGGACGCGTGCGGACCCGCGACCAGCTGCTGAACACGGT
CTGGGGATATGAATTTGAAGGCTATGCCCGCACTGTGGATACCCACGTGCGCAGGCTGCGCCAGAAAATAGGCGACTATG
CCGGGTATATCGAAACCATACGCGGCGTTGGGTATCGCTTCAGAGAATAA

Protein sequence :
MAKDRLLVVEDDGDILQLLTFTLESAGFEVFSAMDGKTGLELAMREKPDLVVLDLMLPGMSGLDVCKDLKRMPETQETPV
IMLTARGEEVDRIVGLELGADDYVVKPFSPRELVLRIKAVLKRGAPFTEQEERTRWRVNGLSLDTEAHRVEIDGDEVTLT
ATEFKLLFELVRNRGRVRTRDQLLNTVWGYEFEGYARTVDTHVRRLRQKIGDYAGYIETIRGVGYRFRE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 5e-35 42
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 5e-35 42
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 5e-35 42
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 5e-35 42
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 3e-33 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dde_2387 YP_388879.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-49 50
Dde_2387 YP_388879.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-44 45
Dde_2387 YP_388879.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-44 45
Dde_2387 YP_388879.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-44 45
Dde_2387 YP_388879.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-44 45
Dde_2387 YP_388879.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-44 45
Dde_2387 YP_388879.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-44 45
Dde_2387 YP_388879.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-44 45
Dde_2387 YP_388879.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-44 45
Dde_2387 YP_388879.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-44 45
Dde_2387 YP_388879.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-44 45
Dde_2387 YP_388879.1 winged helix family two component transcriptional regulator BAC0197 Protein 6e-32 44
Dde_2387 YP_388879.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 8e-45 43
Dde_2387 YP_388879.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 2e-47 43
Dde_2387 YP_388879.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 2e-28 42
Dde_2387 YP_388879.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-40 41
Dde_2387 YP_388879.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-40 41
Dde_2387 YP_388879.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-40 41
Dde_2387 YP_388879.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-40 41
Dde_2387 YP_388879.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-40 41
Dde_2387 YP_388879.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-40 41
Dde_2387 YP_388879.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-40 41
Dde_2387 YP_388879.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-40 41
Dde_2387 YP_388879.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 5e-42 41
Dde_2387 YP_388879.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 6e-35 41
Dde_2387 YP_388879.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 6e-31 41
Dde_2387 YP_388879.1 winged helix family two component transcriptional regulator BAC0125 Protein 3e-30 41
Dde_2387 YP_388879.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-39 41
Dde_2387 YP_388879.1 winged helix family two component transcriptional regulator NC_008702.1.4607594. Protein 8e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dde_2387 YP_388879.1 winged helix family two component transcriptional regulator VFG1389 Protein 5e-31 41