Gene Information

Name : Plut_1212 (Plut_1212)
Accession : YP_375117.1
Strain : Chlorobium luteolum DSM 273
Genome accession: NC_007512
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1370030 - 1370728 bp
Length : 699 bp
Strand : +
Note : -

DNA sequence : 
ATGCGACTGCTGATCATTGAAGACGAACCGGGAATAGCCCGCTTTCTCAAGGAGGGTCTTGAAGAGGAGCACTTTGCCGT
CGACACGGCCTTCGACGGAGAAAGCGGGCTTGAGCTCGGCATGAGCAACGATTACGACCTCTGCCTGATAGACTGGATGC
TGCCGAAACTGAGCGGCATCGAAGTCTGCCGCCAGCTCCGCAAAGCCGGTTCGGCAGTTCCGGTCATTTTCCTCACCGCC
CGCGATACCCTCGACGACGTCGTCTTCGGCCTCGGGGCGGGTGCGGACGACTATGTAAAAAAACCGTTCGCATTCGAAGA
ACTCCTGGCCAGGATCCGCGCCCGCCTGCGACAGAACACACCAACCACGGGCCCGCTCACTGCAGGTGCACTTTGGCTCG
ATCCGGAAACACACCGGGCAGGGTGCAATCGGCATGATCTCACCCTTACACCCAAAGAGTTCGCCCTGCTTGAATACCTC
CTGAGGAACCTTGACAGGGTCTGTACGAGAAGCCGCATCATCGAGCATGTCTGGGACATCCATTTTGATGCTGACACCTC
AGTCATCGACGTCTATGTCAATTTTCTCCGCCGCAAACTCGAAGCCGCAGGATGCACGGGCCTCATCAAGACCGTCCGCG
GGGTCGGCTATGTCATCCGAACACCTGAAGCAAACAACGAGGAGAAGAGTAACGAGTGA

Protein sequence : 
MRLLIIEDEPGIARFLKEGLEEEHFAVDTAFDGESGLELGMSNDYDLCLIDWMLPKLSGIEVCRQLRKAGSAVPVIFLTA
RDTLDDVVFGLGAGADDYVKKPFAFEELLARIRARLRQNTPTTGPLTAGALWLDPETHRAGCNRHDLTLTPKEFALLEYL
LRNLDRVCTRSRIIEHVWDIHFDADTSVIDVYVNFLRRKLEAAGCTGLIKTVRGVGYVIRTPEANNEEKSNE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-30 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-29 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Plut_1212 YP_375117.1 two component transcriptional regulator BAC0638 Protein 8e-30 46
Plut_1212 YP_375117.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-37 45
Plut_1212 YP_375117.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-37 45
Plut_1212 YP_375117.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-37 45
Plut_1212 YP_375117.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-37 45
Plut_1212 YP_375117.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-37 45
Plut_1212 YP_375117.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-37 45
Plut_1212 YP_375117.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-37 45
Plut_1212 YP_375117.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-37 45
Plut_1212 YP_375117.1 two component transcriptional regulator BAC0083 Protein 3e-35 45
Plut_1212 YP_375117.1 two component transcriptional regulator BAC0125 Protein 6e-31 45
Plut_1212 YP_375117.1 two component transcriptional regulator BAC0197 Protein 6e-31 44
Plut_1212 YP_375117.1 two component transcriptional regulator BAC0111 Protein 3e-36 44
Plut_1212 YP_375117.1 two component transcriptional regulator AE015929.1.gene1106. Protein 8e-35 44
Plut_1212 YP_375117.1 two component transcriptional regulator BAC0347 Protein 3e-31 43
Plut_1212 YP_375117.1 two component transcriptional regulator BAC0308 Protein 3e-30 42
Plut_1212 YP_375117.1 two component transcriptional regulator NC_002516.2.879194.p Protein 2e-27 42
Plut_1212 YP_375117.1 two component transcriptional regulator U82965.2.orf14.gene. Protein 4e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Plut_1212 YP_375117.1 two component transcriptional regulator VFG1390 Protein 4e-39 46
Plut_1212 YP_375117.1 two component transcriptional regulator VFG1389 Protein 6e-29 44
Plut_1212 YP_375117.1 two component transcriptional regulator VFG0596 Protein 4e-31 43