Gene Information

Name : Bcep18194_B2768 (Bcep18194_B2768)
Accession : YP_373523.1
Strain :
Genome accession: NC_007511
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3136195 - 3136866 bp
Length : 672 bp
Strand : +
Note : -

DNA sequence :
ATGCGGATACTGATAGTCGAAGACGAACCCAAGATGGCGTCGTACCTCCGGAAAGGGCTGATGGAGGCGAGCTACACGGT
CGACGTCGCGGAAAACGGCAAGGACGGGCTGTTCCTCGCGCTGCACGAGGATTTCGATCTCGTCGTGCTCGACGTGATGC
TGCCGGAAATGGATGGCTTCGAGGTGCTCAAGCGGCTACGCGCGCAGAAGCAGACGCCCGTGCTGCTGCTCACGGCGCGC
GAGGCGATCGAGGACAAGGTCGCCGGGCTCGAGCTGGGTGCCGACGACTATCTGCTCAAGCCGTTCGCGTATGCCGAGTT
CCTCGCGCGCATCCGCTCGCTGCTGCGGCGCGCGCCGCGCAACGTACGCGACATCCTGCATGTCGCCGATCTCGAAGTCG
ACCTGATCCGCCGCCGCGTGCGGCGTGCCGACACCCGCATCGACCTGACCGCGCAGGAATTCGCGCTGCTGCAACTGCTC
GCCGAGCGCGAGGGCGAAGTGCTGACGCGCACCTTCATCACGTCGCAGATCTGGGACATGAATTTCGACAGCGACACGAA
CGTCGTCGATGCGGCGATCAAGCGCCTGCGCGCGAAGATCGACAACACCTATGAGAAGAAACTGATCCACACGATCCGCG
GCATGGGCTACGTGCTCGAGGATCGTTCGTGA

Protein sequence :
MRILIVEDEPKMASYLRKGLMEASYTVDVAENGKDGLFLALHEDFDLVVLDVMLPEMDGFEVLKRLRAQKQTPVLLLTAR
EAIEDKVAGLELGADDYLLKPFAYAEFLARIRSLLRRAPRNVRDILHVADLEVDLIRRRVRRADTRIDLTAQEFALLQLL
AEREGEVLTRTFITSQIWDMNFDSDTNVVDAAIKRLRAKIDNTYEKKLIHTIRGMGYVLEDRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-45 53
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-44 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcep18194_B2768 YP_373523.1 two component heavy metal response transcriptional regulator BAC0197 Protein 1e-51 62
Bcep18194_B2768 YP_373523.1 two component heavy metal response transcriptional regulator BAC0638 Protein 1e-47 61
Bcep18194_B2768 YP_373523.1 two component heavy metal response transcriptional regulator BAC0125 Protein 4e-50 59
Bcep18194_B2768 YP_373523.1 two component heavy metal response transcriptional regulator BAC0083 Protein 1e-48 58
Bcep18194_B2768 YP_373523.1 two component heavy metal response transcriptional regulator BAC0111 Protein 4e-48 58
Bcep18194_B2768 YP_373523.1 two component heavy metal response transcriptional regulator BAC0308 Protein 1e-45 55
Bcep18194_B2768 YP_373523.1 two component heavy metal response transcriptional regulator BAC0347 Protein 3e-41 55
Bcep18194_B2768 YP_373523.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 2e-31 44
Bcep18194_B2768 YP_373523.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 2e-31 44
Bcep18194_B2768 YP_373523.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 2e-31 44
Bcep18194_B2768 YP_373523.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 2e-31 44
Bcep18194_B2768 YP_373523.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 2e-31 44
Bcep18194_B2768 YP_373523.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 2e-31 44
Bcep18194_B2768 YP_373523.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 2e-31 44
Bcep18194_B2768 YP_373523.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 2e-31 44
Bcep18194_B2768 YP_373523.1 two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 2e-26 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcep18194_B2768 YP_373523.1 two component heavy metal response transcriptional regulator VFG0596 Protein 1e-45 53
Bcep18194_B2768 YP_373523.1 two component heavy metal response transcriptional regulator VFG1386 Protein 1e-28 45
Bcep18194_B2768 YP_373523.1 two component heavy metal response transcriptional regulator VFG1390 Protein 9e-29 43
Bcep18194_B2768 YP_373523.1 two component heavy metal response transcriptional regulator VFG1389 Protein 2e-23 42