Gene Information

Name : Bcep18194_B0269 (Bcep18194_B0269)
Accession : YP_371029.1
Strain :
Genome accession: NC_007511
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 287438 - 288016 bp
Length : 579 bp
Strand : -
Note : -

DNA sequence :
ATGGCTGTCAGTCTGTCCAAAGGCGGTAACGTCTCCCTGTCGAAAGAGGCCCCGGGCCTGAGCGAAGTCGTCGTCGGCCT
GGGCTGGGACCCGCGCGTCACCGACGGCACCGAGTTCGACCTCGACGCCTCGATCTTCGTCACCGGTGAAAACGGTAAAG
TCCTGAGCGACGCCAGCTTCATCTTCTACAACAACAAGAAGTCTGCCGACGGTTCCGTCGAGCACCTAGGCGACAACCGT
TCCGGCCAGGGCGATGGCGACGACGAACAGGTCAACGTGAAGCTCACTGGCCTGGCGGCCGACGTGAAGAAGCTGGTCTT
CGCCGTCACGATTCACGATGCCGAGGCTCGCAAGCAGTCATTCGGCCAAGTGAGCAACGCCTATATCCGCGTCCTGAACA
AGGCCGACAGCAAGGAAATCGCGCGCTACGACCTGTCCGAAGACGCTTCCACCGAAACCGCCATGGTCTTCGGCGAGCTG
TATCGCCACAACGACGAGTTCAAGTTCAAGGCGATCGGACAAGGTTTCACCGGTGGCCTGAAGCCTCTGGCAGAAGCTCA
CGGTGTGAGCATCGGTTAA

Protein sequence :
MAVSLSKGGNVSLSKEAPGLSEVVVGLGWDPRVTDGTEFDLDASIFVTGENGKVLSDASFIFYNNKKSADGSVEHLGDNR
SGQGDGDDEQVNVKLTGLAADVKKLVFAVTIHDAEARKQSFGQVSNAYIRVLNKADSKEIARYDLSEDASTETAMVFGEL
YRHNDEFKFKAIGQGFTGGLKPLAEAHGVSIG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-81 93
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 7e-65 72
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-64 72
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-64 72
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-61 65
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-59 64
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-59 64
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 8e-59 63
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 7e-26 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcep18194_B0269 YP_371029.1 stress protein BAC0390 Protein 2e-66 71
Bcep18194_B0269 YP_371029.1 stress protein BAC0389 Protein 6e-59 65