Gene Information

Name : Bcep18194_A3303 (Bcep18194_A3303)
Accession : YP_367549.1
Strain :
Genome accession: NC_007510
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 144625 - 145056 bp
Length : 432 bp
Strand : -
Note : -

DNA sequence : 
ATGAAGATCGGCGAACTGGCCAAAGCGGCCCGCTGCACCCCCGAGACGATCCGTTTCTACGAGAAAGAGGGTCTGATGCC
GGATGCGGAGCGCACCGACTCGAACTACCGCAACTACACCGACGTGCATGTCGAACGGCTGCGCTTCATCCGCAACTGCC
GCGCGCTCGACATGGCGCACGATGAAATCCGCGCGCTGCTGCAGCTCACCGACACGCCGGCCGATCCCTGCGATTCGATC
AATTCGCTGCTCGACGAACACATCGGGCACGTCGACGCGCGCCTCGCGGAACTCACGCATCTGCGCGACCAGCTCACCGA
ATTGCGCCGCCAGTGTGTCGGCGAGCATTCGGTCGAGGATTGCGGCATCGTGCACGGTCTCGCGACGATGGAAACCGTCG
CCCCGGCCGCGAAGCGCTCGCACCTCGGCTGA

Protein sequence : 
MKIGELAKAARCTPETIRFYEKEGLMPDAERTDSNYRNYTDVHVERLRFIRNCRALDMAHDEIRALLQLTDTPADPCDSI
NSLLDEHIGHVDARLAELTHLRDQLTELRRQCVGEHSVEDCGIVHGLATMETVAPAAKRSHLG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 7e-32 49
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 9e-30 45
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 9e-30 45
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 6e-30 45
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 6e-30 45
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 1e-29 44
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 2e-29 44
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 1e-29 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcep18194_A3303 YP_367549.1 MerR family transcriptional regulator BAC0058 Protein 3e-39 56
Bcep18194_A3303 YP_367549.1 MerR family transcriptional regulator BAC0301 Protein 4e-31 53