Gene Information

Name : CHY_1413 (CHY_1413)
Accession : YP_360245.1
Strain : Carboxydothermus hydrogenoformans Z-2901
Genome accession: NC_007503
Putative virulence/resistance : Resistance
Product : DNA-binding response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1265186 - 1265872 bp
Length : 687 bp
Strand : -
Note : identified by match to protein family HMM PF00072; match to protein family HMM PF00486

DNA sequence :
ATGAAAACAATACTTCTGGTGGATGATGAAGAAAAAATCCGGGAAGTATTGCGGCTTTATCTTGAAAAGGAAGGTTTTCT
GGTTTTGGAAGCCCAGGATGGAAAAGAGGCATTAAAGCGTTTTTCCGAGCATAAAATAGATTTAATTATTCTTGATTTGA
TGCTTCCGGAGATTGATGGGATGGAGATTGCCAAAGAAATACGTAAAACCTCGTTGGTTCCTATAATCATGCTGACCGCG
CGGGGAGAAGAGATTGACAAAATTTTAGGCTTAGAAATTGGTGCTGACGATTATGTGGTAAAACCTTTTAGTCCGAGGGA
AGTGGTTGCCCGGGTAAAAGCGGTTTTACGGAGGAGTTCTGGTATCCCAGAAAAAGAGGCGAGTTCGGTTATAAAGCAGG
GTATTTTAGAAATTCATCCGGAGGCCAGAGAAGTAAAGGTTAATGGAGAAGAAGTAGTGCTAACACCCTTAGAGTTTGAT
CTTCTTTTATATTTGGTTACTAATCGAGGGAAAGCTCTTTCGCGGGAACAGTTGCTTGCCAATGTTTGGGGATATGATTA
TTTTGGCGAAGCCCGAACGGTTGATACTCACGTTACCCGTTTGCGGGAAAAGTTGCAAGAGGCAGCTTCCTATATCAAAA
CTGTTTGGGGGGTAGGTTACAAGTTTGAGGTGAAAAACGGTGATTAA

Protein sequence :
MKTILLVDDEEKIREVLRLYLEKEGFLVLEAQDGKEALKRFSEHKIDLIILDLMLPEIDGMEIAKEIRKTSLVPIIMLTA
RGEEIDKILGLEIGADDYVVKPFSPREVVARVKAVLRRSSGIPEKEASSVIKQGILEIHPEAREVKVNGEEVVLTPLEFD
LLLYLVTNRGKALSREQLLANVWGYDYFGEARTVDTHVTRLREKLQEAASYIKTVWGVGYKFEVKNGD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-42 45
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-42 44
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 3e-40 42
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 6e-39 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CHY_1413 YP_360245.1 DNA-binding response regulator NC_012469.1.7685629. Protein 1e-53 54
CHY_1413 YP_360245.1 DNA-binding response regulator HE999704.1.gene2815. Protein 2e-51 52
CHY_1413 YP_360245.1 DNA-binding response regulator DQ212986.1.gene4.p01 Protein 3e-46 49
CHY_1413 YP_360245.1 DNA-binding response regulator NC_002952.2859905.p0 Protein 4e-49 49
CHY_1413 YP_360245.1 DNA-binding response regulator NC_013450.8614421.p0 Protein 5e-49 49
CHY_1413 YP_360245.1 DNA-binding response regulator NC_007793.3914279.p0 Protein 5e-49 49
CHY_1413 YP_360245.1 DNA-binding response regulator NC_002745.1124361.p0 Protein 5e-49 49
CHY_1413 YP_360245.1 DNA-binding response regulator NC_009782.5559369.p0 Protein 5e-49 49
CHY_1413 YP_360245.1 DNA-binding response regulator NC_002951.3237708.p0 Protein 5e-49 49
CHY_1413 YP_360245.1 DNA-binding response regulator NC_003923.1003749.p0 Protein 5e-49 49
CHY_1413 YP_360245.1 DNA-binding response regulator NC_002758.1121668.p0 Protein 5e-49 49
CHY_1413 YP_360245.1 DNA-binding response regulator NC_007622.3794472.p0 Protein 4e-49 49
CHY_1413 YP_360245.1 DNA-binding response regulator NC_009641.5332272.p0 Protein 5e-49 49
CHY_1413 YP_360245.1 DNA-binding response regulator AM180355.1.gene1830. Protein 4e-46 48
CHY_1413 YP_360245.1 DNA-binding response regulator NC_012469.1.7686381. Protein 3e-47 47
CHY_1413 YP_360245.1 DNA-binding response regulator FJ349556.1.orf0.gene Protein 2e-43 46
CHY_1413 YP_360245.1 DNA-binding response regulator AF162694.1.orf4.gene Protein 3e-43 46
CHY_1413 YP_360245.1 DNA-binding response regulator EU250284.1.orf4.gene Protein 4e-43 46
CHY_1413 YP_360245.1 DNA-binding response regulator NC_014475.1.orf0.gen Protein 1e-43 45
CHY_1413 YP_360245.1 DNA-binding response regulator NC_005054.2598277.p0 Protein 1e-43 45
CHY_1413 YP_360245.1 DNA-binding response regulator NC_007622.3794948.p0 Protein 3e-36 44
CHY_1413 YP_360245.1 DNA-binding response regulator NC_003923.1003417.p0 Protein 3e-36 44
CHY_1413 YP_360245.1 DNA-binding response regulator NC_013450.8614146.p0 Protein 3e-36 44
CHY_1413 YP_360245.1 DNA-binding response regulator NC_002951.3238224.p0 Protein 3e-36 44
CHY_1413 YP_360245.1 DNA-binding response regulator NC_007793.3914065.p0 Protein 3e-36 44
CHY_1413 YP_360245.1 DNA-binding response regulator NC_002758.1121390.p0 Protein 3e-36 44
CHY_1413 YP_360245.1 DNA-binding response regulator NC_010079.5776364.p0 Protein 3e-36 44
CHY_1413 YP_360245.1 DNA-binding response regulator NC_002952.2859858.p0 Protein 3e-36 44
CHY_1413 YP_360245.1 DNA-binding response regulator AE015929.1.gene1106. Protein 6e-33 44
CHY_1413 YP_360245.1 DNA-binding response regulator AF155139.2.orf0.gene Protein 5e-42 44
CHY_1413 YP_360245.1 DNA-binding response regulator BAC0596 Protein 5e-36 44
CHY_1413 YP_360245.1 DNA-binding response regulator CP001138.1.gene2239. Protein 5e-36 44
CHY_1413 YP_360245.1 DNA-binding response regulator CP000034.1.gene2186. Protein 5e-36 44
CHY_1413 YP_360245.1 DNA-binding response regulator NC_002695.1.916589.p Protein 4e-36 44
CHY_1413 YP_360245.1 DNA-binding response regulator BAC0039 Protein 5e-36 44
CHY_1413 YP_360245.1 DNA-binding response regulator NC_010400.5986590.p0 Protein 4e-36 43
CHY_1413 YP_360245.1 DNA-binding response regulator NC_010410.6002989.p0 Protein 8e-37 43
CHY_1413 YP_360245.1 DNA-binding response regulator NC_011595.7057856.p0 Protein 8e-37 43
CHY_1413 YP_360245.1 DNA-binding response regulator AE016830.1.gene1681. Protein 6e-46 43
CHY_1413 YP_360245.1 DNA-binding response regulator AF130997.1.orf0.gene Protein 2e-41 43
CHY_1413 YP_360245.1 DNA-binding response regulator CP001918.1.gene5135. Protein 4e-27 43
CHY_1413 YP_360245.1 DNA-binding response regulator CP001918.1.gene3444. Protein 1e-35 43
CHY_1413 YP_360245.1 DNA-binding response regulator CP000647.1.gene2531. Protein 7e-36 43
CHY_1413 YP_360245.1 DNA-binding response regulator AE000516.2.gene3505. Protein 4e-38 43
CHY_1413 YP_360245.1 DNA-binding response regulator AF310956.2.orf0.gene Protein 1e-40 42
CHY_1413 YP_360245.1 DNA-binding response regulator CP000675.2.gene1535. Protein 2e-40 42
CHY_1413 YP_360245.1 DNA-binding response regulator CP001485.1.gene721.p Protein 3e-34 42
CHY_1413 YP_360245.1 DNA-binding response regulator CP004022.1.gene3215. Protein 3e-35 42
CHY_1413 YP_360245.1 DNA-binding response regulator CP001138.1.gene4273. Protein 2e-31 42
CHY_1413 YP_360245.1 DNA-binding response regulator BAC0533 Protein 1e-31 42
CHY_1413 YP_360245.1 DNA-binding response regulator CP000647.1.gene4257. Protein 1e-31 42
CHY_1413 YP_360245.1 DNA-binding response regulator AE016830.1.gene2255. Protein 2e-39 41
CHY_1413 YP_360245.1 DNA-binding response regulator U35369.1.gene1.p01 Protein 2e-39 41
CHY_1413 YP_360245.1 DNA-binding response regulator CP000034.1.gene3834. Protein 1e-30 41
CHY_1413 YP_360245.1 DNA-binding response regulator NC_002695.1.915041.p Protein 1e-30 41
CHY_1413 YP_360245.1 DNA-binding response regulator CP004022.1.gene1676. Protein 1e-35 41
CHY_1413 YP_360245.1 DNA-binding response regulator CP000034.1.gene3671. Protein 2e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CHY_1413 YP_360245.1 DNA-binding response regulator VFG1563 Protein 7e-43 45
CHY_1413 YP_360245.1 DNA-binding response regulator VFG1702 Protein 2e-42 44
CHY_1413 YP_360245.1 DNA-binding response regulator VFG1389 Protein 5e-33 44
CHY_1413 YP_360245.1 DNA-binding response regulator VFG1386 Protein 8e-34 42