Gene Information

Name : Pcar_2834 (Pcar_2834)
Accession : YP_006718613.1
Strain : Pelobacter carbinolicus DSM 2380
Genome accession: NC_007498
Putative virulence/resistance : Unknown
Product : DNA-binding protein of ISPca13
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3312913 - 3313212 bp
Length : 300 bp
Strand : -
Note : -

DNA sequence :
ATGAACCAAAGAAACAGACGATCATTTACGAAAGAGTTCAAGCACGAAGCAGCTAGCCTGGTTGTTGACCAAGGCTATTC
AATAGCTGAAGCCTGCCGTGCAATGGGAGTGGGCCCAACTGCCATGCGCCGCTGGGTCCTGCAACTTCAAGGTGAACAGG
GCGGATTGACGCCAAAAGCGCAGGCGCTGACACCGGAACAGAGACGCATTCAGGAATTAGAAAAACAGGTGCAACGGCTT
GAAAGAGAGAAATCGATTCTAAAAAAGGCTACCGCTCTCTTAATATCGGACGAGATATAG

Protein sequence :
MNQRNRRSFTKEFKHEAASLVVDQGYSIAEACRAMGVGPTAMRRWVLQLQGEQGGLTPKAQALTPEQRRIQELEKQVQRL
EREKSILKKATALLISDEI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 4e-28 65
api80 CAF28554.1 putative transposase Not tested YAPI Protein 2e-19 57
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 7e-22 57
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 7e-22 57
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 7e-22 57
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-21 57
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-21 57
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 7e-22 57
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 7e-22 57
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 7e-22 57
l7045 CAD33744.1 - Not tested PAI I 536 Protein 4e-22 56
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 4e-22 56
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 1e-21 56
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 3e-22 56
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 5e-22 56
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 1e-20 54
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 3e-18 54
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 2e-20 54
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 2e-20 54
unnamed AAC31483.1 L0004 Not tested LEE Protein 1e-20 54
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 1e-18 47
tnpA CAB61575.1 transposase A Not tested HPI Protein 5e-18 46

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pcar_2834 YP_006718613.1 DNA-binding protein of ISPca13 VFG1123 Protein 3e-22 57
Pcar_2834 YP_006718613.1 DNA-binding protein of ISPca13 VFG1485 Protein 1e-22 56
Pcar_2834 YP_006718613.1 DNA-binding protein of ISPca13 VFG1553 Protein 1e-18 54
Pcar_2834 YP_006718613.1 DNA-binding protein of ISPca13 VFG0784 Protein 4e-21 54