Gene Information

Name : Pfl01_3624 (Pfl01_3624)
Accession : YP_349353.1
Strain : Pseudomonas fluorescens Pf0-1
Genome accession: NC_007492
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4098090 - 4098764 bp
Length : 675 bp
Strand : +
Note : -

DNA sequence :
ATGCGAATCCTTGTCGTCGAGGACGAGCTTAAAGCTGCCGAATACTTGCATCAGGGCCTGACCGAAAGTGGTTATATCGT
TGATCACGCGGTCAATGGCGCGGATGGTTTGCACCTGGCGCAACAACAGGTTTATGACCTGATCATCCTCGATGTGAACC
TGCCGGAACTAGACGGCTGGAGCGTGCTGGAACAACTGCGTCGCACCCACTCAACCCGGGTGATGATGCTCACCGCACGC
GGGCGGCTGGCGGACAAGATCCGGGGTCTGGATCTGGGCGCCGATGATTATCTGGTCAAGCCGTTCGAGTTCCCGGAACT
GCTGGCCAGGGTGCGCACGTTGATGCGGCGCAGCGAGAACATCCCGGTGCCGCAGGTGCTCAAGGTTGCCGATCTGGAAC
TCGATCCGGGCCGTCACCGGGCGTTTCGTGGCACGCAGCGCATCGACCTGACCACCAAGGAATTCGCCCTGCTGCACCTG
CTGATGCGCCAGTCCGGCGAAGTGCTGACCCGCACCCAGATCATCTCGCTGGTGTGGGACATGAATTTCGACTGCGACAC
CAACGTGGTCGAAGTCTCGATCCGCCGCTTGCGGGCGAAGATCGACGACCCGTTCGACAGCAAACTGATCCACACCTTGC
GCGGCGTCGGCTATGTGCTGGAGGCGCGGGAATGA

Protein sequence :
MRILVVEDELKAAEYLHQGLTESGYIVDHAVNGADGLHLAQQQVYDLIILDVNLPELDGWSVLEQLRRTHSTRVMMLTAR
GRLADKIRGLDLGADDYLVKPFEFPELLARVRTLMRRSENIPVPQVLKVADLELDPGRHRAFRGTQRIDLTTKEFALLHL
LMRQSGEVLTRTQIISLVWDMNFDCDTNVVEVSIRRLRAKIDDPFDSKLIHTLRGVGYVLEARE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-58 54
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-58 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pfl01_3624 YP_349353.1 two component heavy metal response transcriptional regulator BAC0125 Protein 1e-65 61
Pfl01_3624 YP_349353.1 two component heavy metal response transcriptional regulator BAC0197 Protein 2e-66 60
Pfl01_3624 YP_349353.1 two component heavy metal response transcriptional regulator BAC0083 Protein 4e-63 58
Pfl01_3624 YP_349353.1 two component heavy metal response transcriptional regulator BAC0638 Protein 4e-57 58
Pfl01_3624 YP_349353.1 two component heavy metal response transcriptional regulator BAC0308 Protein 1e-59 57
Pfl01_3624 YP_349353.1 two component heavy metal response transcriptional regulator BAC0111 Protein 7e-61 53
Pfl01_3624 YP_349353.1 two component heavy metal response transcriptional regulator BAC0347 Protein 3e-57 51
Pfl01_3624 YP_349353.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 2e-38 43
Pfl01_3624 YP_349353.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 2e-38 43
Pfl01_3624 YP_349353.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 2e-38 43
Pfl01_3624 YP_349353.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 2e-38 43
Pfl01_3624 YP_349353.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 2e-38 43
Pfl01_3624 YP_349353.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 2e-38 43
Pfl01_3624 YP_349353.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 2e-38 43
Pfl01_3624 YP_349353.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 2e-38 43
Pfl01_3624 YP_349353.1 two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 4e-33 42
Pfl01_3624 YP_349353.1 two component heavy metal response transcriptional regulator U82965.2.orf14.gene. Protein 3e-32 42
Pfl01_3624 YP_349353.1 two component heavy metal response transcriptional regulator NC_012469.1.7685629. Protein 7e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pfl01_3624 YP_349353.1 two component heavy metal response transcriptional regulator VFG0596 Protein 1e-58 54
Pfl01_3624 YP_349353.1 two component heavy metal response transcriptional regulator VFG1389 Protein 3e-37 45
Pfl01_3624 YP_349353.1 two component heavy metal response transcriptional regulator VFG1390 Protein 9e-39 44
Pfl01_3624 YP_349353.1 two component heavy metal response transcriptional regulator VFG1386 Protein 2e-35 43