Gene Information

Name : Pfl01_3519 (Pfl01_3519)
Accession : YP_349248.1
Strain : Pseudomonas fluorescens Pf0-1
Genome accession: NC_007492
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3998706 - 3999389 bp
Length : 684 bp
Strand : +
Note : -

DNA sequence :
ATGACTCGCATCCTCACCATCGAAGACGACGCCGTGACCGCCCGGGAAATTGTCGCCGAACTGAGCAGCCACGGCCTCGA
CGTGGACTGGGTCGACAACGGCCGTGAAGGCCTGGACCGCGCCGTCAGCGGCAACTACGACCTGATCACCCTCGACCGCA
TGCTGCCGGAACTCGATGGCCTGGCCATCGTCACCACCCTGCGCACCATGGGCGTGGCCACGCCGATCCTGATGATCAGC
GCCCTTTCCGATGTCGACGAGCGCGTGCGCGGCTTGCGCGCCGGCGGCGATGATTACCTGACCAAACCGTTCGCCACCGA
TGAAATGGCCGCCCGGGTCGAAGTGTTGCTGCGTCGGCAGAACAGCAACGGCGCCCAGCCGACCACGTTGCAGGTGGCGG
ATCTGCAACTCGACCTGATCAGCCACGAAGCCCGTCGCGCCGAGCAAGTGCTGACGCTGCTGCCGACCGAGTACAAGTTG
CTGGAATTCCTGATGCGCAACAGCGGTCAGATCCTGTCGCGGATGATGATTTTCGAGGAAGTCTGGGGCTACCACTTCGA
CCCCGGCACCAACCTGATCGACGTGCACATCGGCCGTCTGCGCAAGAAGATCGACCCGCCGGGCAATGTCCCGCTGATCC
GTACGGTGCGAGGCTCGGGTTATGTCATTGCCGAACCCGTCTGA

Protein sequence :
MTRILTIEDDAVTAREIVAELSSHGLDVDWVDNGREGLDRAVSGNYDLITLDRMLPELDGLAIVTTLRTMGVATPILMIS
ALSDVDERVRGLRAGGDDYLTKPFATDEMAARVEVLLRRQNSNGAQPTTLQVADLQLDLISHEARRAEQVLTLLPTEYKL
LEFLMRNSGQILSRMMIFEEVWGYHFDPGTNLIDVHIGRLRKKIDPPGNVPLIRTVRGSGYVIAEPV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pfl01_3519 YP_349248.1 two component transcriptional regulator BAC0308 Protein 3e-41 45
Pfl01_3519 YP_349248.1 two component transcriptional regulator BAC0111 Protein 2e-42 45
Pfl01_3519 YP_349248.1 two component transcriptional regulator BAC0347 Protein 1e-39 44
Pfl01_3519 YP_349248.1 two component transcriptional regulator BAC0125 Protein 4e-39 44
Pfl01_3519 YP_349248.1 two component transcriptional regulator BAC0083 Protein 5e-42 44
Pfl01_3519 YP_349248.1 two component transcriptional regulator BAC0197 Protein 2e-40 44
Pfl01_3519 YP_349248.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-33 41
Pfl01_3519 YP_349248.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-33 41
Pfl01_3519 YP_349248.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-33 41
Pfl01_3519 YP_349248.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-33 41
Pfl01_3519 YP_349248.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-33 41
Pfl01_3519 YP_349248.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-33 41
Pfl01_3519 YP_349248.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-33 41
Pfl01_3519 YP_349248.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-33 41
Pfl01_3519 YP_349248.1 two component transcriptional regulator HE999704.1.gene1528. Protein 4e-31 41
Pfl01_3519 YP_349248.1 two component transcriptional regulator BAC0638 Protein 8e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pfl01_3519 YP_349248.1 two component transcriptional regulator VFG1390 Protein 2e-39 42
Pfl01_3519 YP_349248.1 two component transcriptional regulator VFG1389 Protein 5e-34 42
Pfl01_3519 YP_349248.1 two component transcriptional regulator VFG0596 Protein 6e-33 41