Gene Information

Name : Pfl01_3379 (Pfl01_3379)
Accession : YP_349108.1
Strain : Pseudomonas fluorescens Pf0-1
Genome accession: NC_007492
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3853084 - 3853755 bp
Length : 672 bp
Strand : +
Note : -

DNA sequence :
ATGAATATCCTTGTTGTCGAAGACGAACCCAAGGCCGGCAATTATTTGCTCAACGGCTTGCAGGAACTGGGCTACAGCGT
GAGCCTGGCCCGGGACGGCGCCGACGGTCTGCACCTGGCGCTGGAGTTCGACTTCGACGTGATCGTGCTGGACGTGATGA
TGCCGAAAATGGATGGCTGGGAAGTCCTGCGCCGGCTGCGTAAGGAAACCGACACCCCGGTGCTGTTTCTCACCGCCCGC
GATGACATCGCCGACCGGGTCAAGGGGCTTGAACTGGGCGCTGACGACTACCTGATCAAGCCGTTTTCCTTCGCCGAACT
GGTGGCGCGCCTGCGCACCCTGACCCGGCGCGGGCCGATCCATGAAGAAGAGCAATTGCAGGTGGCCGATCTGCAGATCG
ATGTGCTCAAGCGTCGGGTCACCCGGGCCGGCAACCGGATCACCCTGACCAACAAGGAATTCGCCCTGCTGCAACTGTTT
GCCGCCCACACCGGGCAAGTGCTGTCGCGTTCGCTGATCGCCTCGCGGGTGTGGGACATGAATTTCGACAGTGACACCAA
TGTGGTCGATGTCGCCGTGCGCCGCCTGCGGGCGAAGATCGACGATCCGTTCCCGCTCAAGCTGATCCACAGCGTGCGCG
GCATCGGCTACCGCTTCGATACCCAACCATGA

Protein sequence :
MNILVVEDEPKAGNYLLNGLQELGYSVSLARDGADGLHLALEFDFDVIVLDVMMPKMDGWEVLRRLRKETDTPVLFLTAR
DDIADRVKGLELGADDYLIKPFSFAELVARLRTLTRRGPIHEEEQLQVADLQIDVLKRRVTRAGNRITLTNKEFALLQLF
AAHTGQVLSRSLIASRVWDMNFDSDTNVVDVAVRRLRAKIDDPFPLKLIHSVRGIGYRFDTQP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-57 54
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-56 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pfl01_3379 YP_349108.1 two component heavy metal response transcriptional regulator BAC0125 Protein 8e-67 62
Pfl01_3379 YP_349108.1 two component heavy metal response transcriptional regulator BAC0083 Protein 4e-67 62
Pfl01_3379 YP_349108.1 two component heavy metal response transcriptional regulator BAC0638 Protein 2e-59 61
Pfl01_3379 YP_349108.1 two component heavy metal response transcriptional regulator BAC0111 Protein 1e-64 59
Pfl01_3379 YP_349108.1 two component heavy metal response transcriptional regulator BAC0197 Protein 5e-63 59
Pfl01_3379 YP_349108.1 two component heavy metal response transcriptional regulator BAC0308 Protein 2e-59 58
Pfl01_3379 YP_349108.1 two component heavy metal response transcriptional regulator BAC0347 Protein 8e-58 55
Pfl01_3379 YP_349108.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 4e-37 42
Pfl01_3379 YP_349108.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 4e-37 42
Pfl01_3379 YP_349108.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 4e-37 42
Pfl01_3379 YP_349108.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 4e-37 42
Pfl01_3379 YP_349108.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 4e-37 42
Pfl01_3379 YP_349108.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 4e-37 42
Pfl01_3379 YP_349108.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 4e-37 42
Pfl01_3379 YP_349108.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 4e-37 42
Pfl01_3379 YP_349108.1 two component heavy metal response transcriptional regulator AE000516.2.gene3505. Protein 2e-30 42
Pfl01_3379 YP_349108.1 two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 1e-31 41
Pfl01_3379 YP_349108.1 two component heavy metal response transcriptional regulator HE999704.1.gene2815. Protein 4e-31 41
Pfl01_3379 YP_349108.1 two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 1e-32 41
Pfl01_3379 YP_349108.1 two component heavy metal response transcriptional regulator CP001918.1.gene5135. Protein 2e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pfl01_3379 YP_349108.1 two component heavy metal response transcriptional regulator VFG0596 Protein 2e-57 54
Pfl01_3379 YP_349108.1 two component heavy metal response transcriptional regulator VFG1390 Protein 3e-39 45
Pfl01_3379 YP_349108.1 two component heavy metal response transcriptional regulator VFG1386 Protein 4e-37 45
Pfl01_3379 YP_349108.1 two component heavy metal response transcriptional regulator VFG1389 Protein 6e-34 45