Gene Information

Name : Pfl01_0202 (Pfl01_0202)
Accession : YP_345935.1
Strain : Pseudomonas fluorescens Pf0-1
Genome accession: NC_007492
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 240799 - 241479 bp
Length : 681 bp
Strand : +
Note : -

DNA sequence :
ATGCGTTTGCTGGTCGTAGAAGATGAAGCCAAAACCGCGAACTTCATCGCCAAAGGGCTGGGTGAGTCGGGTTTTGCCGT
GGACGTGGCGCTGAATGGCCTCGACGGTCGCTACTTTATTGAGCAGCAGGAATATGACCTGATCATCCTCGACGTGATGC
TGCCGGGCCTCAACGGCTGGCAATTGCTCCAGCTGATCCGCCAGCGCGGCGCCACGCCGGTGCTGTTCCTGACGGCGAAG
GACGCCATCGAAGACCGCGTGCGCGGCCTCGAACTGGGGGCCGATGACTATTTGCTCAAGCCGTTCGCCTTCGCCGAATT
GCTGGCGCGGGTGCGCACGTTGTTGCGGCGCGGCCCCCTGCGTGAAGCCGAGTCGTACAACATCGCCGATCTCGAAATCG
ACGTACTGCGCCGCCGGGTCAGCCGGGGCGGCCAGCGCATCGCCCTGACCAACAAGGAATTCGCTCTCCTGCATCTGCTC
GCCAGCCGTCAGGGTGAAGTGCTGTCGCGCACGCTGATCGCCTCGCAGGTGTGGAACCTGAATTTCGACAGCGACACCAA
CATGGTCGAAGTCGCGGTGCGCCGGCTGCGTTCGAAAGTCGATGATCCGTACATGCCCAAACTGATTCACACCGTGCGCG
GGGTCGGCTATCAACTCGAAGCGCCCGACGATGCGCGCTAG

Protein sequence :
MRLLVVEDEAKTANFIAKGLGESGFAVDVALNGLDGRYFIEQQEYDLIILDVMLPGLNGWQLLQLIRQRGATPVLFLTAK
DAIEDRVRGLELGADDYLLKPFAFAELLARVRTLLRRGPLREAESYNIADLEIDVLRRRVSRGGQRIALTNKEFALLHLL
ASRQGEVLSRTLIASQVWNLNFDSDTNMVEVAVRRLRSKVDDPYMPKLIHTVRGVGYQLEAPDDAR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-57 56
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-56 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator BAC0125 Protein 5e-69 66
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator BAC0638 Protein 2e-59 62
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator BAC0083 Protein 1e-65 61
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator BAC0111 Protein 2e-65 61
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator BAC0197 Protein 2e-64 60
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator BAC0308 Protein 1e-61 59
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator BAC0347 Protein 7e-59 58
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator AE000516.2.gene3505. Protein 4e-31 44
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 5e-37 43
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 5e-37 43
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 5e-37 43
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 5e-37 43
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 5e-37 43
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 5e-37 43
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 5e-37 43
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 5e-37 43
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator NC_002952.2859905.p0 Protein 5e-34 42
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator NC_007793.3914279.p0 Protein 7e-34 42
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator NC_003923.1003749.p0 Protein 1e-33 42
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator NC_007622.3794472.p0 Protein 5e-34 42
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator NC_002745.1124361.p0 Protein 7e-34 42
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator NC_009782.5559369.p0 Protein 7e-34 42
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator NC_002951.3237708.p0 Protein 7e-34 42
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator NC_002758.1121668.p0 Protein 7e-34 42
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator NC_009641.5332272.p0 Protein 7e-34 42
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator NC_013450.8614421.p0 Protein 7e-34 42
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 1e-31 41
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 2e-26 41
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator NC_012469.1.7685629. Protein 2e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator VFG0596 Protein 2e-57 56
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator VFG1390 Protein 1e-37 44
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator VFG1386 Protein 7e-33 41
Pfl01_0202 YP_345935.1 two component heavy metal response transcriptional regulator VFG1389 Protein 8e-33 41