Gene Information

Name : RSP_4166 (RSP_4166)
Accession : REF_jgi:RSP_4166
Strain :
Genome accession: NC_007490
Putative virulence/resistance : Unknown
Product : Transposase, IS66 Orf2 like
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 25976 - 26329 bp
Length : 354 bp
Strand : -
Note : IMG reference gene:2512957747; PFAM: IS66 Orf2 like protein

DNA sequence :
GTGATCCTGCCGGGCGGGATCACCCGGGTCTATCTGGCGACGCGGCCAGTCGATTTCCGAAAGGGCCATGCCGGGCTGGC
GCTGATCGTGCAGAGCGTGCTGGGCCACGATCCGTACAACGGCGCGATCTACCTGTTCCGCTCGAAACGCGGTGACCAGC
TGAAGTGCCTGGTGTGGGACCAGACCGGCCTCGTTCTGGTCTACAAGAAGCTCGAGGGCGGCGCCTTCCACTGGCCGAAG
CCGGCCGATGGGGTGATCCGGCTGTCGCCGGCGCAGTTCTCGGCCCTCATCGAAGGGCTGGACTGGCGAGCGGTCCGGGC
CGAGCGGCGGCCGCGGCCGCGACTGGCCGGATAG

Protein sequence :
MILPGGITRVYLATRPVDFRKGHAGLALIVQSVLGHDPYNGAIYLFRSKRGDQLKCLVWDQTGLVLVYKKLEGGAFHWPK
PADGVIRLSPAQFSALIEGLDWRAVRAERRPRPRLAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 6e-20 50
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 4e-17 48
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 4e-17 48
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 1e-16 47
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 5e-15 45
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 5e-15 45
unnamed AAL99258.1 unknown Not tested LEE Protein 1e-14 44
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-14 44
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 1e-14 44
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-14 44
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-14 44
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-14 44
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-14 44
unnamed AAC31493.1 L0014 Not tested LEE Protein 1e-14 44
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 1e-14 44
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 1e-10 43
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 2e-15 43
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 2e-15 43
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-15 43
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 6e-14 43
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 6e-14 43
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 8e-14 42
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 8e-14 42
tnpB AEZ06052.1 transposition helper protein Not tested Tn6167 Protein 3e-09 42
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 2e-14 41
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 2e-14 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RSP_4166 REF_jgi:RSP_4166 Transposase, IS66 Orf2 like VFG1665 Protein 4e-17 47
RSP_4166 REF_jgi:RSP_4166 Transposase, IS66 Orf2 like VFG1698 Protein 1e-15 45
RSP_4166 REF_jgi:RSP_4166 Transposase, IS66 Orf2 like VFG0792 Protein 6e-15 44
RSP_4166 REF_jgi:RSP_4166 Transposase, IS66 Orf2 like VFG1052 Protein 1e-14 44
RSP_4166 REF_jgi:RSP_4166 Transposase, IS66 Orf2 like VFG1709 Protein 6e-15 44
RSP_4166 REF_jgi:RSP_4166 Transposase, IS66 Orf2 like VFG1517 Protein 5e-11 43
RSP_4166 REF_jgi:RSP_4166 Transposase, IS66 Orf2 like VFG1737 Protein 6e-16 43