Gene Information

Name : Noc_2760 (Noc_2760)
Accession : YP_344739.1
Strain : Nitrosococcus oceani ATCC 19707
Genome accession: NC_007484
Putative virulence/resistance : Resistance
Product : Hg(II)-responsive transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 3132209 - 3132616 bp
Length : 408 bp
Strand : +
Note : -

DNA sequence :
ATGAACGAAGCACCGGAAAACCTGACCATCGGCACTTTTGCCAAGGCGGCCGGGGTCAACGTGGAGACGATCCGCTTCTA
TCAGCATAAGGGGCTGTTGCCGACGCCGGAGCGGCCTCCTGGGGGCATCCGGCGCTACGGCAACGCCGACGTGGCGCGGG
TTAAATTCGTGAAGGCGGCGCAGCGACTGGGATTCAGCCTAGACGAGATCGGGCAACTGCTAAAGCTGGAAGACGGTATG
CATTGCAGCGAGGCAGCGGCGCTGGCGTCGCAGCGGTTGGATGATGTGCGCGCCAAGCTCGCTGACCTGCACCGGATCGA
GGCTGTATTGACCGAGCTAGTCAACGAATGCCACACGCATCAAGGCGATGTATCGTGCCCGCTCATCACCGCCTTGCATG
ACGGCTAA

Protein sequence :
MNEAPENLTIGTFAKAAGVNVETIRFYQHKGLLPTPERPPGGIRRYGNADVARVKFVKAAQRLGFSLDEIGQLLKLEDGM
HCSEAAALASQRLDDVRAKLADLHRIEAVLTELVNECHTHQGDVSCPLITALHDG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 4e-47 77
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 1e-46 73
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 2e-46 73
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 1e-46 69
merR AFG30124.1 MerR Not tested PAGI-2 Protein 2e-45 68
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 2e-45 68
merR AGK07025.1 MerR Not tested SGI1 Protein 5e-45 68
merR AGK07083.1 MerR Not tested SGI1 Protein 5e-45 68
merR ACK44535.1 MerR Not tested SGI1 Protein 2e-45 68
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 2e-45 68
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 2e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Noc_2760 YP_344739.1 Hg(II)-responsive transcriptional regulator BAC0688 Protein 4e-47 71
Noc_2760 YP_344739.1 Hg(II)-responsive transcriptional regulator BAC0683 Protein 7e-48 70
Noc_2760 YP_344739.1 Hg(II)-responsive transcriptional regulator BAC0687 Protein 4e-46 69
Noc_2760 YP_344739.1 Hg(II)-responsive transcriptional regulator BAC0232 Protein 4e-46 69
Noc_2760 YP_344739.1 Hg(II)-responsive transcriptional regulator BAC0684 Protein 9e-48 69
Noc_2760 YP_344739.1 Hg(II)-responsive transcriptional regulator BAC0686 Protein 6e-47 68
Noc_2760 YP_344739.1 Hg(II)-responsive transcriptional regulator BAC0689 Protein 1e-45 68