Gene Information

Name : Tbd_2791 (Tbd_2791)
Accession : YP_316549.1
Strain : Thiobacillus denitrificans ATCC 25259
Genome accession: NC_007404
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2871834 - 2872499 bp
Length : 666 bp
Strand : +
Note : -

DNA sequence :
ATGCGGGTATTGCTGATCGAAGACGACGACCTGATCGCCCACGGTGTCCAGGCTGGCCTGGGCGCGCGGGGCCTGACGGT
GGATCGGGTCGAGACCGCGGCGCAGGCGCGAACCATGCTCGCGACCGTGCACTACCAACTGGCGATTCTCGATCTCGGTC
TGCCCGACGAGGATGGCATGAGTCTGCTGCAGCGCTGGCGCGCGGCGGGCGTCGATCTGCCGGTGCTGGTGCTGACCGCG
CGCGACGCCGTGGAGGACCGGGTCGCCGGACTGCGCGCCGGCGCGGACGATTACCTGCTCAAACCCTTCGACCTCGACGA
ACTGCTCGCCCGCCTGCAGGCGCTGCTGCGCCGCGCCGCCGGGCGCAGCGCGGATGTCGTCGAGCATGGCGCGCTGCGGC
TCGACCTCGAGCGCGGTGACGTCTCTCTCAACGGCCGTCCCGTCGTGCTGACGCGGCGCGAGCTGGCGCTGCTGGCCGCG
CTGCTGCACGCGCGCGGCCGCATCCTCAGCGCCGACCAGCTCAAGGACAGCCTGTACGGGTTCAGCGAGGAGATCGAGAG
CAACGCACTGAGCGTGCATATCCACCACCTGCGGCGCAAGCTCGGCGCCGACCTGATCGAGACCGTGCGCGGCCTCGGCT
ACCGCTTCAACATGTCAGACGCATGA

Protein sequence :
MRVLLIEDDDLIAHGVQAGLGARGLTVDRVETAAQARTMLATVHYQLAILDLGLPDEDGMSLLQRWRAAGVDLPVLVLTA
RDAVEDRVAGLRAGADDYLLKPFDLDELLARLQALLRRAAGRSADVVEHGALRLDLERGDVSLNGRPVVLTRRELALLAA
LLHARGRILSADQLKDSLYGFSEEIESNALSVHIHHLRRKLGADLIETVRGLGYRFNMSDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 3e-37 57
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-15 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tbd_2791 YP_316549.1 two component transcriptional regulator BAC0487 Protein 7e-33 46
Tbd_2791 YP_316549.1 two component transcriptional regulator CP000647.1.gene1136. Protein 1e-25 45
Tbd_2791 YP_316549.1 two component transcriptional regulator BAC0530 Protein 1e-25 45
Tbd_2791 YP_316549.1 two component transcriptional regulator CP001918.1.gene2526. Protein 7e-25 44
Tbd_2791 YP_316549.1 two component transcriptional regulator CP001138.1.gene1939. Protein 2e-25 43
Tbd_2791 YP_316549.1 two component transcriptional regulator CP000034.1.gene2022. Protein 8e-25 42
Tbd_2791 YP_316549.1 two component transcriptional regulator NC_002695.1.913289.p Protein 2e-24 42
Tbd_2791 YP_316549.1 two component transcriptional regulator NC_002516.2.879194.p Protein 3e-24 42
Tbd_2791 YP_316549.1 two component transcriptional regulator BAC0638 Protein 9e-16 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tbd_2791 YP_316549.1 two component transcriptional regulator VFG0473 Protein 3e-27 45
Tbd_2791 YP_316549.1 two component transcriptional regulator VFG0475 Protein 2e-25 43
Tbd_2791 YP_316549.1 two component transcriptional regulator VFG1389 Protein 3e-12 43
Tbd_2791 YP_316549.1 two component transcriptional regulator VFG1390 Protein 5e-17 42
Tbd_2791 YP_316549.1 two component transcriptional regulator VFG0596 Protein 4e-16 41