Gene Information

Name : SSON_2667 (SSON_2667)
Accession : YP_311525.1
Strain : Shigella sonnei Ss046
Genome accession: NC_007384
Putative virulence/resistance : Unknown
Product : protein encoded within IS
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 2827927 - 2828274 bp
Length : 348 bp
Strand : -
Note : Code: L; COG: COG3436

DNA sequence :
ATGATCCCGTTACCTTCCGGGATCAAAATTTGGCTGGTTGCCGGTATCACCGATATGAGAAATGGCTTCAACGGCCTGGC
TGCGAAAGTACAGACGGCGCTGAAAGACGATCCCATGTCCGGCCATGTTTTCATTTTCCGGGGCCGCAGCGGCAGTCAGG
TTAAACTGCTGTGGTCCACCAGTGACGGACTGTGCCTCCTGACCAAACGGCTGGAGCGTGGGCGCTTCGCCTGGCCGTCA
GCCCGTGATGGCAAAGTGTTCCTTACACAGGCGCAGCTGGCGATGCTGCTGGAAGGTATCGACTGGCGACAGCCTAAGCG
GCTGCTGACCTCCCTGACCATGCTGTAA

Protein sequence :
MIPLPSGIKIWLVAGITDMRNGFNGLAAKVQTALKDDPMSGHVFIFRGRSGSQVKLLWSTSDGLCLLTKRLERGRFAWPS
ARDGKVFLTQAQLAMLLEGIDWRQPKRLLTSLTML

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 1e-48 99
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-48 99
unnamed AAC31493.1 L0014 Not tested LEE Protein 1e-48 99
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-48 99
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 1e-48 99
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-48 99
unnamed AAL99258.1 unknown Not tested LEE Protein 1e-48 99
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-48 99
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-47 98
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-47 98
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 1e-35 97
unnamed AAL08461.1 unknown Not tested SRL Protein 3e-48 97
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 7e-48 96
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 7e-48 96
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 5e-39 77
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 5e-39 77
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 1e-38 76
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 8e-37 71
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 8e-37 71
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 4e-34 65
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 4e-34 65
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 8e-29 65
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 7e-35 64
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 7e-35 64
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 9e-35 63

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SSON_2667 YP_311525.1 protein encoded within IS VFG1709 Protein 5e-49 99
SSON_2667 YP_311525.1 protein encoded within IS VFG0792 Protein 5e-49 99
SSON_2667 YP_311525.1 protein encoded within IS VFG1052 Protein 1e-48 97
SSON_2667 YP_311525.1 protein encoded within IS VFG1517 Protein 4e-36 97
SSON_2667 YP_311525.1 protein encoded within IS VFG1698 Protein 2e-48 96
SSON_2667 YP_311525.1 protein encoded within IS VFG1665 Protein 5e-39 76
SSON_2667 YP_311525.1 protein encoded within IS VFG1737 Protein 3e-35 63