Name : rpsN (Ecaj_0599) Accession : YP_303231.1 Strain : Ehrlichia canis Jake Genome accession: NC_007354 Putative virulence/resistance : Unknown Product : 30S ribosomal protein S14 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0199 EC number : - Position : 857386 - 857691 bp Length : 306 bp Strand : - Note : located in the peptidyl transferase center and involved in assembly of 30S ribosome subunit; similar to what is observed with proteins L31 and L33, some proteins in this family contain CXXC motifs that are involved in zinc binding; if two copies are prese DNA sequence : ATGTCAAGAAAATCTGTAATACAAAGAAATTTAAAACGTATATCTATTTGTAGTAGATTAAAAAGTAAAAGAGATGAGCT AAAGGCTATAATTAAAGATCAATCTATTTCTATGAATGATAGATTTTTAGCTCAAGTTAAGTTGTCTAAGCTTCCTAGAG ATTCATCTTATATTAGAATTAGAAACAGATGTTTAGTTACTGGAAGGCCTAGGGGTTGTTATAGGAAATTTAAAGTTTCT CGTATTGTTTTACGTCAATTAGGTTCAATTGGTCAAATACCTGGATTGACTAAATCTAGTTGGTAA Protein sequence : MSRKSVIQRNLKRISICSRLKSKRDELKAIIKDQSISMNDRFLAQVKLSKLPRDSSYIRIRNRCLVTGRPRGCYRKFKVS RIVLRQLGSIGQIPGLTKSSW |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
ef0103 | AAM75306.1 | EF0103 | Not tested | Not named | Protein | 6e-09 | 43 |
rpsN | NP_814350.1 | 30S ribosomal protein S14 | Not tested | Not named | Protein | 9e-09 | 43 |