Gene Information

Name : SSP0049 (SSP0049)
Accession : YP_300139.1
Strain : Staphylococcus saprophyticus ATCC 15305
Genome accession: NC_007350
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : S : Function unknown
COG ID : COG4333
EC number : -
Position : 59517 - 60023 bp
Length : 507 bp
Strand : +
Note : similar to gi|22094438|gb|AAM91898.1| [Staphylococcus aureus], percent identity 75 in 168 aa, BLASTP E(): 5e-71

DNA sequence :
ATGCAGAATATACAATGTATATTAGAAACTGAAGCAATATTTAGTGACGATAATCAACATCGTTATTTACTCAAAAAAAC
GTGGGACAAAGATAAAAAGATAATTTCAGTTATAACTTGTTATCCAAATTTTGAAGGAACCAAAAAATTAGATTTAACGA
CTCAATTAATTCTAAATAAAGTATCTGAGATGAAAGACTTCGGATCAATTAATTTTGTGAACCTATATTCAAACATGATA
ACAACCACAAATATAAAGCATATGGCAAATAGTCATGATAAGCATACTGATATTCATATTATGAAAGTAGTGAAAGAATC
GGATGAAGTGATATTAGCATGGGGTGCTTACGCTAAAAAACCGATTGTTGAAATGCGTGTCAATGAAATATTAGAGATGT
TGAAACCACATAAAAAGAAAGTGAAACAACTCATCAACCCAGAAACGAATGAAATTATGCATCCACTCAACCCTAAGGCA
CGTCAAAAATGGATTTTGAAATCATAG

Protein sequence :
MQNIQCILETEAIFSDDNQHRYLLKKTWDKDKKIISVITCYPNFEGTKKLDLTTQLILNKVSEMKDFGSINFVNLYSNMI
TTTNIKHMANSHDKHTDIHIMKVVKESDEVILAWGAYAKKPIVEMRVNEILEMLKPHKKKVKQLINPETNEIMHPLNPKA
RQKWILKS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SSP0049 YP_300139.1 hypothetical protein Not tested SCC15305cap Protein 3e-75 100
SARLGA251_00330 YP_005754048.1 hypothetical protein Not tested Type-XI SCCmec Protein 5e-61 77
unnamed BAB46979.2 hypothetical protein Not tested Type-IIIinv SCCmec Protein 5e-60 75
unnamed BAB47669.1 hypothetical protein Not tested Type-III SCCmec Protein 1e-59 75
unnamed BAC53831.1 hypothetical protein Not tested SRImec-III and SCCmec-III region Protein 1e-59 75
unnamed ACL99835.1 hypothetical protein Not tested Type-V SCCmec Protein 2e-59 75
unnamed BAG06194.1 hypothetical protein Not tested Type-VII SCCmec Protein 2e-59 75
SAPIG0037 YP_005732847.1 hypothetical protein Not tested Type-V SCCmec Protein 3e-59 75
SSP0031 YP_300121.1 hypothetical protein Not tested SCC15305RM Protein 4e-48 70
MW0035 NP_644850.1 hypothetical protein Not tested Type-IV SCCmec Protein 3e-43 64
SAUSA300_0036 YP_492756.1 hypothetical protein Not tested Type-IV SCCmec Protein 3e-43 64
SACOL0037 YP_184948.1 hypothetical protein Not tested Type-I SCCmec Protein 7e-44 64
SAMSHR1132_00360 YP_005324560.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 3e-43 64
unnamed BAB72112.1 hypothetical protein Not tested Type-IVa SCCmec Protein 2e-43 64
unnamed BAB72131.1 hypothetical protein Not tested Type-IVb SCCmec Protein 2e-43 64
unnamed BAC67564.1 hypothetical protein Not tested Type-IVc SCCmec Protein 2e-43 64
unnamed BAA94331.1 hypothetical protein Not tested Type-I SCCmec Protein 5e-44 64
unnamed BAB47602.1 hypothetical protein Not tested Type-III SCCmec Protein 4e-54 64
unnamed BAB46974.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 4e-54 64
unnamed ACL99847.1 hypothetical protein Not tested Type-V SCCmec Protein 1e-44 63
unnamed BAG06215.2 hypothetical protein Not tested Type-VII SCCmec Protein 2e-43 63
SAS0029 YP_042162.1 hypothetical protein Not tested SCC476 Protein 2e-43 63
unnamed BAA94663.1 - Not tested Type-II SCCmec Protein 1e-41 62
SH0059 YP_251974.1 hypothetical protein Not tested SCCmec Protein 1e-40 62
SAR0056 YP_039527.1 hypothetical protein Not tested Type-II SCCmec Protein 2e-41 62
SERP2504 YP_190046.1 hypothetical protein Not tested Type-II SCCmec Protein 2e-41 62
SE0030 NP_763585.1 hypothetical protein Not tested SCCpbp4 Protein 6e-43 62
SAV0058 NP_370582.1 hypothetical protein Not tested Type-II SCCmec Protein 2e-41 62
SA0054 NP_373294.1 hypothetical protein Not tested Type-II SCCmec Protein 2e-41 62
unnamed BAD24838.1 hypothetical protein Not tested Type-V SCCmec Protein 5e-48 61
SAPIG0053 YP_005732863.1 hypothetical protein Not tested Type-V SCCmec Protein 3e-36 61