Gene Information

Name : SSP0047 (SSP0047)
Accession : YP_300137.1
Strain : Staphylococcus saprophyticus ATCC 15305
Genome accession: NC_007350
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 58756 - 59094 bp
Length : 339 bp
Strand : +
Note : similar to gi|16579848|gb|AAL26663.1| [Staphylococcus aureus], percent identity 93 in 112 aa, BLASTP E(): 6e-58

DNA sequence :
ATGACATTAGAACTACAACTCAAGCACTATATAACCAACTTATTCAATCTGCCAAGGGATGAAAAATGGGAATGTGAATC
TATCGAGGAAGTCGCTGATGATATCCTACCAGACCAATATGTAAGGCTTGGGCCACTCAGTAATAAAATACTACAGACTA
ATACCTACTACTCTGATACACTTCACAAAAGCAATATATATCCGTTCATTCTCTATTATCAGAAACAACTCATAGCTATC
GGCTTTATCGATGAAAATCACGATATGGATTTCTTATATCTACACAACACAGTCATGCCCCTTTTGGATCAACGATACTT
ACTAACAGGAGGACAATAA

Protein sequence :
MTLELQLKHYITNLFNLPRDEKWECESIEEVADDILPDQYVRLGPLSNKILQTNTYYSDTLHKSNIYPFILYYQKQLIAI
GFIDENHDMDFLYLHNTVMPLLDQRYLLTGGQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SSP0047 YP_300137.1 hypothetical protein Not tested SCC15305cap Protein 3e-48 100
unnamed AAL26663.1 unknown Not tested SCCcap1 Protein 6e-46 94
unnamed ACL99833.1 hypothetical protein Not tested Type-V SCCmec Protein 4e-45 92
SSP0034 YP_300124.1 hypothetical protein Not tested SCC15305RM Protein 5e-45 92
unnamed BAG06192.1 hypothetical protein Not tested Type-VII SCCmec Protein 4e-45 92
SARLGA251_00350 YP_005754050.1 hypothetical protein Not tested Type-XI SCCmec Protein 1e-45 92
unnamed BAC53833.1 hypothetical protein Not tested SRImec-III and SCCmec-III region Protein 3e-44 92
unnamed BAB47671.1 hypothetical protein Not tested Type-III SCCmec Protein 3e-44 92
unnamed BAB47598.1 hypothetical protein Not tested Type-III SCCmec Protein 5e-41 84
unnamed BAB83488.1 - Not tested SCC 12263 Protein 5e-25 53
SAPIG0051 YP_005732861.1 hypothetical protein Not tested Type-V SCCmec Protein 3e-25 52
unnamed ACL99845.1 hypothetical protein Not tested Type-V SCCmec Protein 3e-25 52
unnamed BAG06213.1 hypothetical protein Not tested Type-VII SCCmec Protein 2e-25 52
unnamed BAB46981.2 hypothetical protein Not tested Type-IIIinv SCCmec Protein 9e-24 51
SH0057 YP_251972.1 hypothetical protein Not tested SCCmec Protein 5e-25 51
SAS0031 YP_042164.1 hypothetical protein Not tested SCC476 Protein 5e-19 51
unnamed BAA94329.1 hypothetical protein Not tested Type-I SCCmec Protein 2e-19 51
SACOL0040 YP_184951.1 hypothetical protein Not tested Type-I SCCmec Protein 2e-19 51
unnamed BAD24835.1 hypothetical protein Not tested Type-V SCCmec Protein 8e-25 50
SE0055 NP_763610.1 hypothetical protein Not tested SCCpbp4 Protein 1e-18 50
SE0033 NP_763588.1 hypothetical protein Not tested SCCpbp4 Protein 1e-16 49
unnamed BAB72110.1 hypothetical protein Not tested Type-IVa SCCmec Protein 5e-17 48
unnamed BAB72129.1 hypothetical protein Not tested Type-IVb SCCmec Protein 5e-17 48
unnamed BAC67562.1 hypothetical protein Not tested Type-IVc SCCmec Protein 5e-17 48
SAMSHR1132_00390 YP_005324562.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 8e-17 48
MW0037 NP_644852.1 hypothetical protein Not tested Type-IV SCCmec Protein 8e-17 48
SAV0060 NP_370584.1 hypothetical protein Not tested Type-II SCCmec Protein 9e-19 48
SAR0058 YP_039529.1 hypothetical protein Not tested Type-II SCCmec Protein 3e-19 48
SA0056 NP_373296.1 hypothetical protein Not tested Type-II SCCmec Protein 3e-19 48
SERP2501 YP_190043.1 hypothetical protein Not tested Type-II SCCmec Protein 3e-19 48
unnamed BAA94661.1 - Not tested Type-II SCCmec Protein 2e-19 48