Gene Information

Name : SSP0034 (SSP0034)
Accession : YP_300124.1
Strain : Staphylococcus saprophyticus ATCC 15305
Genome accession: NC_007350
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 40603 - 40941 bp
Length : 339 bp
Strand : -
Note : similar to gi|16579848|gb|AAL26663.1| [Staphylococcus aureus], percent identity 94 in 112 aa, BLASTP E(): 9e-57

DNA sequence :
ATGACACTAGAACAACAACTCAAGCACTATATAACCAACTTATTCAATCTGCCAAAGGACGAAGTGTGGCACTGCGAATC
TATCGAGGAAATCGCTGATGATATCTTACCCAATCAATATGTAAGACTTGGCCCACTCAGTAATAAAATACTTCAGACTA
ATACCTACTACTCTGACACACTTCACGAAAGTAATATCTATCCTTTCATTCTATACTATCAGAAACAACTCATAGCCATC
GGTTATATCGACGAAAATCACGATATGGATTTCTTATACCTACACAACACTATCATGCCTCTTTTGGATCAACGATACTT
ACTAACAGGAGGACAATAA

Protein sequence :
MTLEQQLKHYITNLFNLPKDEVWHCESIEEIADDILPNQYVRLGPLSNKILQTNTYYSDTLHESNIYPFILYYQKQLIAI
GYIDENHDMDFLYLHNTIMPLLDQRYLLTGGQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SSP0034 YP_300124.1 hypothetical protein Not tested SCC15305RM Protein 8e-48 100
unnamed ACL99833.1 hypothetical protein Not tested Type-V SCCmec Protein 2e-47 99
unnamed BAG06192.1 hypothetical protein Not tested Type-VII SCCmec Protein 2e-47 99
unnamed AAL26663.1 unknown Not tested SCCcap1 Protein 9e-45 95
unnamed BAB47671.1 hypothetical protein Not tested Type-III SCCmec Protein 2e-43 93
unnamed BAC53833.1 hypothetical protein Not tested SRImec-III and SCCmec-III region Protein 2e-43 93
SARLGA251_00350 YP_005754050.1 hypothetical protein Not tested Type-XI SCCmec Protein 6e-45 92
SSP0047 YP_300137.1 hypothetical protein Not tested SCC15305cap Protein 5e-45 92
unnamed BAB47598.1 hypothetical protein Not tested Type-III SCCmec Protein 8e-41 82
SAPIG0051 YP_005732861.1 hypothetical protein Not tested Type-V SCCmec Protein 6e-26 53
unnamed BAB83488.1 - Not tested SCC 12263 Protein 5e-26 53
unnamed ACL99845.1 hypothetical protein Not tested Type-V SCCmec Protein 6e-26 53
unnamed BAG06213.1 hypothetical protein Not tested Type-VII SCCmec Protein 4e-26 53
SH0057 YP_251972.1 hypothetical protein Not tested SCCmec Protein 8e-26 52
unnamed BAB46981.2 hypothetical protein Not tested Type-IIIinv SCCmec Protein 2e-24 52
SAS0031 YP_042164.1 hypothetical protein Not tested SCC476 Protein 2e-20 52
SACOL0040 YP_184951.1 hypothetical protein Not tested Type-I SCCmec Protein 8e-21 52
unnamed BAA94329.1 hypothetical protein Not tested Type-I SCCmec Protein 6e-21 52
unnamed BAD24835.1 hypothetical protein Not tested Type-V SCCmec Protein 2e-25 51
SE0055 NP_763610.1 hypothetical protein Not tested SCCpbp4 Protein 7e-20 51
unnamed BAC67562.1 hypothetical protein Not tested Type-IVc SCCmec Protein 2e-18 50
SAMSHR1132_00390 YP_005324562.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 3e-18 50
MW0037 NP_644852.1 hypothetical protein Not tested Type-IV SCCmec Protein 3e-18 50
unnamed BAB72110.1 hypothetical protein Not tested Type-IVa SCCmec Protein 2e-18 50
unnamed BAB72129.1 hypothetical protein Not tested Type-IVb SCCmec Protein 2e-18 50
SE0033 NP_763588.1 hypothetical protein Not tested SCCpbp4 Protein 7e-18 50
unnamed BAA94661.1 - Not tested Type-II SCCmec Protein 1e-20 47
SAV0060 NP_370584.1 hypothetical protein Not tested Type-II SCCmec Protein 7e-20 47
SAR0058 YP_039529.1 hypothetical protein Not tested Type-II SCCmec Protein 2e-20 47
SA0056 NP_373296.1 hypothetical protein Not tested Type-II SCCmec Protein 2e-20 47
SERP2501 YP_190043.1 hypothetical protein Not tested Type-II SCCmec Protein 2e-20 47