Gene Information

Name : SSP0032 (SSP0032)
Accession : YP_300122.1
Strain : Staphylococcus saprophyticus ATCC 15305
Genome accession: NC_007350
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 40196 - 40507 bp
Length : 312 bp
Strand : -
Note : similar to gi|14021046|dbj|BAB47670.1| [Staphylococcus aureus], percent identity 74 in 103 aa, BLASTP E(): 4e-41

DNA sequence :
ATGAATAGATATATCACCCGGGGTATCGCCAACAACTTACCTAATATCTTACAACACCAATTATGGCAACTCGTATCTGA
GCGAGAACAAGAACAAACCAAAGATAATACCTTAGTAGATTATTTTCATATATTCCAGTTCAATACACATCGCAATCAAT
TATATATCAAACACAAACAAGAACGACCAGCGTATGTGAAAACTCAAAAGGCAAATATCAATCAACCTATCAATATCAAT
AAGGTCTACATTATCCGTGAAGATGATGTAGACCTTTCTTATTACATTATGTTATTACCAAATGAATATTAA

Protein sequence :
MNRYITRGIANNLPNILQHQLWQLVSEREQEQTKDNTLVDYFHIFQFNTHRNQLYIKHKQERPAYVKTQKANINQPININ
KVYIIREDDVDLSYYIMLLPNEY

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SSP0032 YP_300122.1 hypothetical protein Not tested SCC15305RM Protein 3e-43 100
unnamed ACL99834.1 hypothetical protein Not tested Type-V SCCmec Protein 3e-39 89
SAPIG0036 YP_005732846.1 hypothetical protein Not tested Type-V SCCmec Protein 4e-39 89
unnamed BAG06193.1 hypothetical protein Not tested Type-VII SCCmec Protein 3e-39 89
SARLGA251_00340 YP_005754049.1 hypothetical protein Not tested Type-XI SCCmec Protein 2e-35 76
unnamed BAB47670.1 hypothetical protein Not tested Type-III SCCmec Protein 3e-35 75
unnamed BAC53832.1 hypothetical protein Not tested SRImec-III and SCCmec-III region Protein 3e-35 75
SSP0048 YP_300138.1 hypothetical protein Not tested SCC15305cap Protein 7e-35 74
unnamed BAB47601.1 hypothetical protein Not tested Type-III SCCmec Protein 5e-34 73
unnamed AAL26664.1 unknown Not tested SCCcap1 Protein 4e-28 72
unnamed BAB83490.1 - Not tested SCC 12263 Protein 2e-14 49
unnamed BAB46980.2 hypothetical protein Not tested Type-IIIinv SCCmec Protein 1e-16 48
SE0053 NP_763608.1 hypothetical protein Not tested SCCpbp4 Protein 3e-14 48
unnamed BAA94662.1 - Not tested Type-II SCCmec Protein 7e-14 48
SAR0057 YP_039528.1 hypothetical protein Not tested Type-II SCCmec Protein 1e-13 48
SAV0059 NP_370583.1 hypothetical protein Not tested Type-II SCCmec Protein 1e-13 48
SA0055 NP_373295.1 hypothetical protein Not tested Type-II SCCmec Protein 1e-13 48
SERP2503 YP_190045.1 hypothetical protein Not tested Type-II SCCmec Protein 1e-13 48
SACOL0038 YP_184949.1 hypothetical protein Not tested Type-I SCCmec Protein 1e-14 46
unnamed BAD24837.1 hypothetical protein Not tested Type-V SCCmec Protein 3e-15 46
unnamed BAA94330.1 hypothetical protein Not tested Type-I SCCmec Protein 7e-15 46
SE0031 NP_763586.1 hypothetical protein Not tested SCCpbp4 Protein 7e-15 45
SAPIG0052 YP_005732862.1 hypothetical protein Not tested Type-V SCCmec Protein 7e-15 45
SH0058 YP_251973.1 hypothetical protein Not tested SCCmec Protein 6e-15 45
SAS0030 YP_042163.1 hypothetical protein Not tested SCC476 Protein 2e-14 45
unnamed ACL99846.1 hypothetical protein Not tested Type-V SCCmec Protein 9e-16 45
unnamed BAG06214.1 hypothetical protein Not tested Type-VII SCCmec Protein 3e-14 45
unnamed BAC67563.1 hypothetical protein Not tested Type-IVc SCCmec Protein 2e-14 44
SAMSHR1132_00370 YP_005324561.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 3e-14 44
MW0036 NP_644851.1 hypothetical protein Not tested Type-IV SCCmec Protein 3e-14 44
unnamed BAB72111.1 hypothetical protein Not tested Type-IVa SCCmec Protein 2e-14 44
unnamed BAB72130.1 hypothetical protein Not tested Type-IVb SCCmec Protein 2e-14 44