Name : SSP2384 (SSP2384) Accession : YP_302474.1 Strain : Staphylococcus saprophyticus ATCC 15305 Genome accession: NC_007350 Putative virulence/resistance : Resistance Product : arsenical resistance operon repressor Function : - COG functional category : K : Transcription COG ID : COG0640 EC number : - Position : 2452485 - 2452799 bp Length : 315 bp Strand : - Note : similar to gi|16119216|ref|NP_395552.1| [Staphylococcus aureus subsp. aureus N315], percent identity 82 in 104 aa, BLASTP E(): 3e-45 DNA sequence : ATGTCTTATAAAGTATTGTCATCTATGTTAAAAATCTTGTCAGATCCAAGTAGATTAGAAATATTAGATTTACTTTCTTG TGGTGAACTATGTGCGTGTGATTTATTAGAACACTTTCAATTTTCTCAGCCTACATTAAGTCACCATATGAAATTATTGG TAGCGAATGACTTAGTTACGACACGTAAAGTGGGCAATAAACATATGTACCAACTTAACCACACATTATTAGAATCAATT CAGCAAAATTTAAACGTGATTCACACGTCTAATCAAGAATGTGTATGTAAAAATATGAAATCAGGTGAATGTTAA Protein sequence : MSYKVLSSMLKILSDPSRLEILDLLSCGELCACDLLEHFQFSQPTLSHHMKLLVANDLVTTRKVGNKHMYQLNHTLLESI QQNLNVIHTSNQECVCKNMKSGEC |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
arsR | YP_005754066.1 | arsenical resistance operon repressor | Not tested | Type-XI SCCmec | Protein | 2e-34 | 74 |
arsR | YP_252018.1 | arsenical resistance operon repressor | Not tested | SCCmec | Protein | 4e-33 | 72 |
arsR | YP_252025.1 | arsenical resistance operon repressor | Not tested | SCCmec | Protein | 3e-29 | 61 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
SSP2384 | YP_302474.1 | arsenical resistance operon repressor | BAC0592 | Protein | 5e-38 | 82 |
SSP2384 | YP_302474.1 | arsenical resistance operon repressor | BAC0590 | Protein | 4e-37 | 82 |