Gene Information

Name : SSP0021 (SSP0021)
Accession : YP_300111.1
Strain : Staphylococcus saprophyticus ATCC 15305
Genome accession: NC_007350
Putative virulence/resistance : Virulence
Product : response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 28100 - 28801 bp
Length : 702 bp
Strand : +
Note : similar to gi|27466936|ref|NP_763573.1| [Staphylococcus epidermidis ATCC 12228], percent identity 96 in 233 aa, BLASTP E(): e-128

DNA sequence : 
ATGGCTAGAAAAGTTGTTGTAGTCGATGATGAAAAACCAATTGCTGATATTTTAGAATTTAATTTGAAAAAAGAAGGCTA
CGAAGTATTTTGTGCCTATGATGGTAACGATGCAGTCGATTTAATCTATGATGAAGAACCAGACATCGTGTTATTAGACA
TTATGTTACCTGGTCGCGACGGCATGGAAGTTTGTCGTGAAGTACGTAAAAAATACGAAATGCCAATTATCATGTTAACA
GCGAAAGACTCAGAAATTGATAAAGTATTAGGTCTTGAGCTAGGTGCAGATGACTATGTGACGAAACCATTTAGCACACG
TGAATTAATCGCGCGTGTTAAAGCCAACTTACGTCGTCATTATTCACAACCAGCACAAGAAGTTAATGATGCGTCCAATG
AAATTACGATTAAAGATATCGTCATCTATCCAGATGCATACTCTATTAAAAAACGTGGCGATGATATCGAATTAACACAC
CGTGAATTTGAATTATTCCATTACTTATCTAAACATATGGGACAAGTAATGACACGTGAACATTTATTACAAACTGTTTG
GGGTTATGACTATTTTGGTGATGTACGTACAGTAGACGTAACAATTCGTCGTTTACGTGAAAAAATCGAGGATGATCCAT
CTCATCCAGAATATATTGTTACACGTCGTGGTGTTGGATATTTCCTCCAACAACATGAATAG

Protein sequence : 
MARKVVVVDDEKPIADILEFNLKKEGYEVFCAYDGNDAVDLIYDEEPDIVLLDIMLPGRDGMEVCREVRKKYEMPIIMLT
AKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHYSQPAQEVNDASNEITIKDIVIYPDAYSIKKRGDDIELTH
REFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIVTRRGVGYFLQQHE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-37 42
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-32 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-37 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SSP0021 YP_300111.1 response regulator NC_012469.1.7685629. Protein 5e-71 63
SSP0021 YP_300111.1 response regulator NC_002952.2859905.p0 Protein 5e-57 53
SSP0021 YP_300111.1 response regulator NC_003923.1003749.p0 Protein 5e-57 53
SSP0021 YP_300111.1 response regulator NC_002758.1121668.p0 Protein 7e-57 53
SSP0021 YP_300111.1 response regulator NC_009641.5332272.p0 Protein 7e-57 53
SSP0021 YP_300111.1 response regulator NC_013450.8614421.p0 Protein 7e-57 53
SSP0021 YP_300111.1 response regulator NC_007793.3914279.p0 Protein 7e-57 53
SSP0021 YP_300111.1 response regulator NC_007622.3794472.p0 Protein 5e-57 53
SSP0021 YP_300111.1 response regulator NC_002745.1124361.p0 Protein 7e-57 53
SSP0021 YP_300111.1 response regulator NC_009782.5559369.p0 Protein 7e-57 53
SSP0021 YP_300111.1 response regulator NC_002951.3237708.p0 Protein 7e-57 53
SSP0021 YP_300111.1 response regulator HE999704.1.gene2815. Protein 7e-52 50
SSP0021 YP_300111.1 response regulator NC_012469.1.7686381. Protein 1e-46 48
SSP0021 YP_300111.1 response regulator AE016830.1.gene1681. Protein 1e-48 46
SSP0021 YP_300111.1 response regulator AE000516.2.gene3505. Protein 1e-41 45
SSP0021 YP_300111.1 response regulator NC_014475.1.orf0.gen Protein 1e-42 44
SSP0021 YP_300111.1 response regulator NC_005054.2598277.p0 Protein 1e-42 44
SSP0021 YP_300111.1 response regulator AM180355.1.gene1830. Protein 2e-44 44
SSP0021 YP_300111.1 response regulator FJ349556.1.orf0.gene Protein 2e-41 44
SSP0021 YP_300111.1 response regulator AF130997.1.orf0.gene Protein 8e-42 43
SSP0021 YP_300111.1 response regulator AF155139.2.orf0.gene Protein 1e-38 43
SSP0021 YP_300111.1 response regulator NC_010079.5776364.p0 Protein 4e-36 41
SSP0021 YP_300111.1 response regulator NC_002952.2859858.p0 Protein 4e-36 41
SSP0021 YP_300111.1 response regulator NC_007622.3794948.p0 Protein 4e-36 41
SSP0021 YP_300111.1 response regulator NC_003923.1003417.p0 Protein 4e-36 41
SSP0021 YP_300111.1 response regulator NC_013450.8614146.p0 Protein 4e-36 41
SSP0021 YP_300111.1 response regulator NC_002951.3238224.p0 Protein 4e-36 41
SSP0021 YP_300111.1 response regulator NC_007793.3914065.p0 Protein 4e-36 41
SSP0021 YP_300111.1 response regulator NC_002758.1121390.p0 Protein 4e-36 41
SSP0021 YP_300111.1 response regulator AE015929.1.gene1106. Protein 5e-31 41
SSP0021 YP_300111.1 response regulator HE999704.1.gene1528. Protein 2e-35 41
SSP0021 YP_300111.1 response regulator AF162694.1.orf4.gene Protein 1e-36 41
SSP0021 YP_300111.1 response regulator DQ212986.1.gene4.p01 Protein 3e-41 41
SSP0021 YP_300111.1 response regulator CP001918.1.gene5135. Protein 6e-31 41
SSP0021 YP_300111.1 response regulator CP000034.1.gene3834. Protein 4e-34 41
SSP0021 YP_300111.1 response regulator NC_002695.1.915041.p Protein 4e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SSP0021 YP_300111.1 response regulator VFG1702 Protein 6e-38 42
SSP0021 YP_300111.1 response regulator VFG0596 Protein 5e-33 41
SSP0021 YP_300111.1 response regulator VFG1563 Protein 1e-37 41