Gene Information

Name : Reut_A2490 (Reut_A2490)
Accession : YP_296695.1
Strain :
Genome accession: NC_007347
Putative virulence/resistance : Virulence
Product : heavy metal response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2730316 - 2731002 bp
Length : 687 bp
Strand : +
Note : -

DNA sequence :
ATGAAACTGCTAGTAGTGGAAGACGAGGCCAAGACCGGCGAATACCTGCGGCAGGGCCTGACAGAGGCCGGCTTCGTGGT
GGACCTGGCCGCGAATGGACTCGATGGCCACCATCTGGCCATGAGCGAGGCCTACGATCTGATCATCCTCGACGTGATGC
TGCCGGACGTGGACGGCTGGCGCATCGTGCAGACGCTGCGCGCGGCCGGCAACCGCGTGCCGGTGCTGTTCCTGACTGCG
CGCGACAGCGTGGCGGACCGCGTCAAGGGGCTCGAGCTGGGCGCGGACGACTACCTGGTCAAGCCATTCGCGTTCGCCGA
ACTGCTTGCGCGCGTACGCACGTTGCTACGCCGTGGCAGCGTGCAGGCGAGCGTGGATCGCGTACAGGTCGGCGACCTGG
TACTGGATCTGGCGCGCCGGCGTGCGTCGCGCGGCGGGCGCCGCATCGTGCTGACGAGCAAGGAGTTCTCGCTGCTCGAG
CTGCTCGTGCGCCGGCGCGGCGAAGTACTGCCGCGCTCGCTGATTGCGTCGCAAGTCTGGGACATGAACTTCGACAGCGA
CAGTAATGTGATCGACGTCGCCATCCGCCGCCTGCGCGCGAAGATCGACGACGACTTCGACACCAAGCTGATCCAGACGG
TGCGCGGCATGGGCTACGTGCTGGAAGGTCCCGAGGACACGGTGTGA

Protein sequence :
MKLLVVEDEAKTGEYLRQGLTEAGFVVDLAANGLDGHHLAMSEAYDLIILDVMLPDVDGWRIVQTLRAAGNRVPVLFLTA
RDSVADRVKGLELGADDYLVKPFAFAELLARVRTLLRRGSVQASVDRVQVGDLVLDLARRRASRGGRRIVLTSKEFSLLE
LLVRRRGEVLPRSLIASQVWDMNFDSDSNVIDVAIRRLRAKIDDDFDTKLIQTVRGMGYVLEGPEDTV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-51 60
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-50 59

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Reut_A2490 YP_296695.1 heavy metal response regulator BAC0083 Protein 1e-62 71
Reut_A2490 YP_296695.1 heavy metal response regulator BAC0111 Protein 1e-65 71
Reut_A2490 YP_296695.1 heavy metal response regulator BAC0638 Protein 1e-61 69
Reut_A2490 YP_296695.1 heavy metal response regulator BAC0347 Protein 2e-58 67
Reut_A2490 YP_296695.1 heavy metal response regulator BAC0197 Protein 1e-57 66
Reut_A2490 YP_296695.1 heavy metal response regulator BAC0308 Protein 3e-55 64
Reut_A2490 YP_296695.1 heavy metal response regulator BAC0125 Protein 4e-55 64
Reut_A2490 YP_296695.1 heavy metal response regulator BAC0487 Protein 7e-29 42
Reut_A2490 YP_296695.1 heavy metal response regulator NC_013450.8614146.p0 Protein 7e-30 42
Reut_A2490 YP_296695.1 heavy metal response regulator NC_002951.3238224.p0 Protein 7e-30 42
Reut_A2490 YP_296695.1 heavy metal response regulator NC_007793.3914065.p0 Protein 7e-30 42
Reut_A2490 YP_296695.1 heavy metal response regulator NC_002758.1121390.p0 Protein 7e-30 42
Reut_A2490 YP_296695.1 heavy metal response regulator NC_010079.5776364.p0 Protein 7e-30 42
Reut_A2490 YP_296695.1 heavy metal response regulator NC_002952.2859858.p0 Protein 7e-30 42
Reut_A2490 YP_296695.1 heavy metal response regulator NC_007622.3794948.p0 Protein 7e-30 42
Reut_A2490 YP_296695.1 heavy metal response regulator NC_003923.1003417.p0 Protein 7e-30 42
Reut_A2490 YP_296695.1 heavy metal response regulator NC_002952.2859905.p0 Protein 3e-27 42
Reut_A2490 YP_296695.1 heavy metal response regulator NC_009641.5332272.p0 Protein 2e-27 42
Reut_A2490 YP_296695.1 heavy metal response regulator NC_013450.8614421.p0 Protein 2e-27 42
Reut_A2490 YP_296695.1 heavy metal response regulator NC_007622.3794472.p0 Protein 3e-27 42
Reut_A2490 YP_296695.1 heavy metal response regulator NC_007793.3914279.p0 Protein 2e-27 42
Reut_A2490 YP_296695.1 heavy metal response regulator NC_003923.1003749.p0 Protein 2e-27 42
Reut_A2490 YP_296695.1 heavy metal response regulator NC_002745.1124361.p0 Protein 2e-27 42
Reut_A2490 YP_296695.1 heavy metal response regulator NC_009782.5559369.p0 Protein 2e-27 42
Reut_A2490 YP_296695.1 heavy metal response regulator NC_002951.3237708.p0 Protein 2e-27 42
Reut_A2490 YP_296695.1 heavy metal response regulator NC_002758.1121668.p0 Protein 2e-27 42
Reut_A2490 YP_296695.1 heavy metal response regulator NC_002516.2.879194.p Protein 2e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Reut_A2490 YP_296695.1 heavy metal response regulator VFG0596 Protein 1e-51 60
Reut_A2490 YP_296695.1 heavy metal response regulator VFG1390 Protein 2e-36 46
Reut_A2490 YP_296695.1 heavy metal response regulator VFG1389 Protein 2e-28 46
Reut_A2490 YP_296695.1 heavy metal response regulator VFG1386 Protein 2e-28 41