Gene Information

Name : Reut_A1815 (Reut_A1815)
Accession : YP_296024.1
Strain :
Genome accession: NC_007347
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1985262 - 1985936 bp
Length : 675 bp
Strand : -
Note : -

DNA sequence :
ATGAAGATTCTTGTTGTGGAAGACGAGCCCAAGACGGGCGAATACCTGCGCAAAGGCCTGACCGAGTCATCCTTTGTGGT
CGATGTCGCGGTGACGGGCGGAGATGGCCTGCACCAGGCCACGGAACACGAATACGACCTGATCATCCTGGATGTCATGC
TGCCGGGCATGAGCGGGTGGGACGTGCTCAGGCAGCTGCGCGAGCGCAAGGACACGCCGGTCCTGTTCCTGACGGCCAGG
GACGAAGTGGAAGACCGTGTCCGCGGCCTGGAGCTCGGCGGCGACGACTATCTTGCCAAACCGTTTGCCTTTGTCGAACT
GCTCGCGCGGGTACGCACGCTGCTGCGGCGCGGACCGGTACGCGAGGCCGACCGTATCGAAATCGGCGACCTGGAGATCG
ACGTGATCCGCCATCGCGTCACCCGGGCTGGCCAGCGCATCGACCTGACTCCGCGCGAATTCGCCCTGCTGCATTTCCTG
GCCAGGCGGCATGGGGAGGTGCTCAGCCGCACGCACATTGCCTCCCAGGTGTGGGACATGAACTTCGACAGCGATACCAA
TGTGGTGGACGTGGCCATCCGCCGCCTGCGCGCAAAGATGGACGACCACTTCGCGCCCAAGCTGATCCACAGCGTACGCG
GCATCGGCTACGTCCTCGAAATTCGGCCATCGTGA

Protein sequence :
MKILVVEDEPKTGEYLRKGLTESSFVVDVAVTGGDGLHQATEHEYDLIILDVMLPGMSGWDVLRQLRERKDTPVLFLTAR
DEVEDRVRGLELGGDDYLAKPFAFVELLARVRTLLRRGPVREADRIEIGDLEIDVIRHRVTRAGQRIDLTPREFALLHFL
ARRHGEVLSRTHIASQVWDMNFDSDTNVVDVAIRRLRAKMDDHFAPKLIHSVRGIGYVLEIRPS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-61 59
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-60 58

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator BAC0125 Protein 1e-74 68
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator BAC0197 Protein 1e-72 67
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator BAC0083 Protein 2e-70 65
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator BAC0638 Protein 6e-62 63
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator BAC0111 Protein 6e-69 61
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator BAC0308 Protein 1e-64 60
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator BAC0347 Protein 2e-61 57
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator AE000516.2.gene3505. Protein 2e-32 45
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 8e-43 44
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 8e-43 44
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 8e-43 44
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 8e-43 44
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 8e-43 44
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 8e-43 44
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 8e-43 44
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 8e-43 44
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator NC_007622.3794472.p0 Protein 2e-39 44
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator NC_002952.2859905.p0 Protein 2e-39 44
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator NC_007793.3914279.p0 Protein 2e-39 44
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator NC_002745.1124361.p0 Protein 2e-39 44
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator NC_009782.5559369.p0 Protein 2e-39 44
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator NC_002951.3237708.p0 Protein 2e-39 44
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator NC_002758.1121668.p0 Protein 2e-39 44
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator NC_009641.5332272.p0 Protein 2e-39 44
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator NC_013450.8614421.p0 Protein 2e-39 44
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator NC_003923.1003749.p0 Protein 3e-39 43
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 3e-37 42
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 3e-27 42
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator NC_012469.1.7685629. Protein 8e-36 41
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator HE999704.1.gene2815. Protein 2e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator VFG0596 Protein 2e-61 59
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator VFG1389 Protein 7e-39 47
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator VFG1390 Protein 7e-41 44
Reut_A1815 YP_296024.1 two component heavy metal response transcriptional regulator VFG1386 Protein 2e-40 44