Gene Information

Name : Daro_2815 (Daro_2815)
Accession : YP_286015.1
Strain : Dechloromonas aromatica RCB
Genome accession: NC_007298
Putative virulence/resistance : Virulence
Product : response regulator receiver:transcriptional regulatory protein, C-terminal
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3022429 - 3023085 bp
Length : 657 bp
Strand : +
Note : -

DNA sequence : 
ATGCGCATTCTGCTTGTCGAAGATGATCCTGAACTGGGCGACGGCTTGACCGTCGGCTTGCGTCAGGCCGGTTTTGCCGT
CGATTGGCTGCGCGACGGCAATTCAGCTGACCAGGCACTGCAGAGTGAGAGCTTCGACTTCGTCGTGCTCGATCTCGGTC
TGCCGCGTCTTTCCGGCATGGAAGTGCTGAATCGCGCCCGGGGCCGCGGTCAGGACATGCCCATCCTGATTCTGACCGCC
CGCGACGCTACCGGCGACAAGGTTTCCGGACTGGATGCCGGGGCTGACGACTACCTCGTCAAACCGATCGACCTCGACGA
GTTGACCGCCCGCATCCGCGCCCTGACCCGGCGCAGCGCCGGCCGTGCTGCCCCGCTATTGACCCATGGCGAGCTGAGTA
TCGACCTTGCCGCCCACCGCGTCACCCTGGCCGGGCAGGAAATCGAACTGTCCAGCCGCGAGTTCTCGCTGTTGCAGATG
CTTCTGGAAAGTGCTGGCCGTGTGCTGACTCGCACCCAGCTCGAACAATCGCTCTATGGCTGGCACGACGAACCCGACAG
CAACGCCCTCGAAGTACACATCCACCACCTGCGCAAGAAGCTGGGCAGCGAATTGATCCGCACCCTGCGCGGGGTCGGCT
ACACCATTCCCAAGTGA

Protein sequence : 
MRILLVEDDPELGDGLTVGLRQAGFAVDWLRDGNSADQALQSESFDFVVLDLGLPRLSGMEVLNRARGRGQDMPILILTA
RDATGDKVSGLDAGADDYLVKPIDLDELTARIRALTRRSAGRAAPLLTHGELSIDLAAHRVTLAGQEIELSSREFSLLQM
LLESAGRVLTRTQLEQSLYGWHDEPDSNALEVHIHHLRKKLGSELIRTLRGVGYTIPK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 4e-38 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Daro_2815 YP_286015.1 response regulator receiver:transcriptional regulatory protein, C-terminal BAC0487 Protein 2e-41 46
Daro_2815 YP_286015.1 response regulator receiver:transcriptional regulatory protein, C-terminal NC_002952.2859858.p0 Protein 2e-34 42
Daro_2815 YP_286015.1 response regulator receiver:transcriptional regulatory protein, C-terminal NC_007622.3794948.p0 Protein 2e-34 42
Daro_2815 YP_286015.1 response regulator receiver:transcriptional regulatory protein, C-terminal NC_003923.1003417.p0 Protein 2e-34 42
Daro_2815 YP_286015.1 response regulator receiver:transcriptional regulatory protein, C-terminal NC_013450.8614146.p0 Protein 2e-34 42
Daro_2815 YP_286015.1 response regulator receiver:transcriptional regulatory protein, C-terminal NC_002951.3238224.p0 Protein 2e-34 42
Daro_2815 YP_286015.1 response regulator receiver:transcriptional regulatory protein, C-terminal NC_007793.3914065.p0 Protein 2e-34 42
Daro_2815 YP_286015.1 response regulator receiver:transcriptional regulatory protein, C-terminal NC_002758.1121390.p0 Protein 2e-34 42
Daro_2815 YP_286015.1 response regulator receiver:transcriptional regulatory protein, C-terminal NC_010079.5776364.p0 Protein 2e-34 42
Daro_2815 YP_286015.1 response regulator receiver:transcriptional regulatory protein, C-terminal BAC0083 Protein 5e-37 42
Daro_2815 YP_286015.1 response regulator receiver:transcriptional regulatory protein, C-terminal BAC0347 Protein 4e-34 41
Daro_2815 YP_286015.1 response regulator receiver:transcriptional regulatory protein, C-terminal BAC0638 Protein 1e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Daro_2815 YP_286015.1 response regulator receiver:transcriptional regulatory protein, C-terminal VFG0473 Protein 2e-45 46
Daro_2815 YP_286015.1 response regulator receiver:transcriptional regulatory protein, C-terminal VFG1390 Protein 5e-36 43