Gene Information

Name : emrE (BPEN_570)
Accession : YP_278056.1
Strain : Candidatus Blochmannia pennsylvanicus BPEN
Genome accession: NC_007292
Putative virulence/resistance : Resistance
Product : auxillary SMR family multidrug transporter
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 678687 - 679016 bp
Length : 330 bp
Strand : +
Note : ortholog to Escherichia coli bnum: b0543; MultiFun: Cell processes 5.6.4; Cell structure 6.1; Transport 4.2.A.7, 4.S.126

DNA sequence :
ATGGATTATTTATATTTATTTATTGCTATTCTTTCCGAGGTTATTGCTACTTCTTACTTAAAAGCATCTGAAGGATTTAG
TAAATTATATCCTGTTATTGTAGTAATAATTGGTTATACATTCTCTTTTATGTTGTTATCTTTAGTGTTGCAAACAATAC
CGATGGGTATTGCATATTCCTGTTGGGCTGGACTTGGTATTGTGTTTATTACTGCAGCGGGATATATATTTTATGATCAA
AAATTAGATAGTTTAGCTGTTATTGGTATTGCTTTCATTATTATTGGTGTTGTATTAATTAATATATTTTCCAATACGAT
AAAACACTAA

Protein sequence :
MDYLYLFIAILSEVIATSYLKASEGFSKLYPVIVVIIGYTFSFMLLSLVLQTIPMGIAYSCWAGLGIVFITAAGYIFYDQ
KLDSLAVIGIAFIIIGVVLINIFSNTIKH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 4e-19 59
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 4e-19 59
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 4e-19 59
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 4e-19 59
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 4e-19 59
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 4e-19 59
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 4e-19 59
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 4e-19 59
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 4e-19 59
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 4e-19 59
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 4e-19 59
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 4e-19 59
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 6e-19 59
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 4e-19 59
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 4e-19 59
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-19 59
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 6e-19 59
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 4e-19 59
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 4e-19 59
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-19 59
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 6e-19 59
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 4e-19 59
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-19 59
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 6e-19 59
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 4e-19 59
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 4e-19 59
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-19 59
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 6e-19 59
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 4e-19 59
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 4e-19 59

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
emrE YP_278056.1 auxillary SMR family multidrug transporter NC_010410.6003348.p0 Protein 3e-18 61
emrE YP_278056.1 auxillary SMR family multidrug transporter BAC0002 Protein 3e-18 61
emrE YP_278056.1 auxillary SMR family multidrug transporter CP004022.1.gene1549. Protein 1e-18 61
emrE YP_278056.1 auxillary SMR family multidrug transporter BAC0322 Protein 2e-19 59
emrE YP_278056.1 auxillary SMR family multidrug transporter BAC0323 Protein 2e-19 59
emrE YP_278056.1 auxillary SMR family multidrug transporter BAC0324 Protein 3e-18 54
emrE YP_278056.1 auxillary SMR family multidrug transporter CP001138.1.gene1489. Protein 9e-15 53
emrE YP_278056.1 auxillary SMR family multidrug transporter BAC0329 Protein 1e-16 50
emrE YP_278056.1 auxillary SMR family multidrug transporter NC_002695.1.913273.p Protein 2e-13 50
emrE YP_278056.1 auxillary SMR family multidrug transporter BAC0150 Protein 2e-13 50
emrE YP_278056.1 auxillary SMR family multidrug transporter BAC0377 Protein 2e-17 49
emrE YP_278056.1 auxillary SMR family multidrug transporter BAC0326 Protein 7e-16 46
emrE YP_278056.1 auxillary SMR family multidrug transporter BAC0325 Protein 4e-15 44
emrE YP_278056.1 auxillary SMR family multidrug transporter BAC0321 Protein 2e-14 44