Gene Information

Name : Psyc_0864 (Psyc_0864)
Accession : YP_264151.1
Strain : Psychrobacter arcticus 273-4
Genome accession: NC_007204
Putative virulence/resistance : Unknown
Product : IS1329/IS3/IS911 transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 1032301 - 1032612 bp
Length : 312 bp
Strand : -
Note : Contains a fis type helix turn helix binding motif, which is found in a number of proteins involved in recombination and transcriptional regulation.

DNA sequence :
ATGAGCCAAAAACGCAACCAATATACTCGAGAATTCAAGCTAGAAGCCATAAGCTTAGTGATTGATCACAACCGTAGCAT
AACTGACGTGGCAAGCTCACTTGGCATTGGCAAATCCACCTTGCAGAAATGGCTGAGTCAATACCGTCAAGAAATGAGTG
GCCAAGCACCTAAAGTCGGCAATGCTTTAACGGATGAACAGCGAGAGCTCCAAGAACTGCGTAAAGAGAATAAGCGCTTG
AGGATGGAGCGCGACATCTTAAAAAAGGCTTCCGCTCTGCTGGCGTTGGACAATCTAAACGACTATCGCTAA

Protein sequence :
MSQKRNQYTREFKLEAISLVIDHNRSITDVASSLGIGKSTLQKWLSQYRQEMSGQAPKVGNALTDEQRELQELRKENKRL
RMERDILKKASALLALDNLNDYR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-12 44
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 8e-12 44
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 5e-12 44
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 8e-12 44
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-12 44
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-12 44
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-12 44
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-12 44
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 7e-14 43
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 9e-09 42
orfD AGK07033.1 IS1133 transposase; OrfD Not tested SGI1 Protein 6e-05 41
orfD AGK07091.1 IS1133 transposase; OrfD Not tested SGI1 Protein 6e-05 41
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 2e-11 41
l7045 CAD33744.1 - Not tested PAI I 536 Protein 2e-11 41
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 3e-12 41
unnamed CAD33780.1 putative transposase Not tested PAI I 536 Protein 9e-12 41
tnpA CAB61575.1 transposase A Not tested HPI Protein 2e-13 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Psyc_0864 YP_264151.1 IS1329/IS3/IS911 transposase VFG1123 Protein 2e-12 44
Psyc_0864 YP_264151.1 IS1329/IS3/IS911 transposase VFG1485 Protein 8e-12 41
Psyc_0864 YP_264151.1 IS1329/IS3/IS911 transposase VFG1566 Protein 1e-12 41
Psyc_0864 YP_264151.1 IS1329/IS3/IS911 transposase VFG1521 Protein 4e-12 41