Name : Psyc_0864 (Psyc_0864) Accession : YP_264151.1 Strain : Psychrobacter arcticus 273-4 Genome accession: NC_007204 Putative virulence/resistance : Unknown Product : IS1329/IS3/IS911 transposase Function : - COG functional category : L : Replication, recombination and repair COG ID : COG2963 EC number : - Position : 1032301 - 1032612 bp Length : 312 bp Strand : - Note : Contains a fis type helix turn helix binding motif, which is found in a number of proteins involved in recombination and transcriptional regulation. DNA sequence : ATGAGCCAAAAACGCAACCAATATACTCGAGAATTCAAGCTAGAAGCCATAAGCTTAGTGATTGATCACAACCGTAGCAT AACTGACGTGGCAAGCTCACTTGGCATTGGCAAATCCACCTTGCAGAAATGGCTGAGTCAATACCGTCAAGAAATGAGTG GCCAAGCACCTAAAGTCGGCAATGCTTTAACGGATGAACAGCGAGAGCTCCAAGAACTGCGTAAAGAGAATAAGCGCTTG AGGATGGAGCGCGACATCTTAAAAAAGGCTTCCGCTCTGCTGGCGTTGGACAATCTAAACGACTATCGCTAA Protein sequence : MSQKRNQYTREFKLEAISLVIDHNRSITDVASSLGIGKSTLQKWLSQYRQEMSGQAPKVGNALTDEQRELQELRKENKRL RMERDILKKASALLALDNLNDYR |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
orfA | ACX47959.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 5e-12 | 44 |
VC1790 | NP_231425.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 8e-12 | 44 |
VPI2_0009c | ACA01826.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 5e-12 | 44 |
orfA | YP_001217330.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 8e-12 | 44 |
orfA | AGK06911.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 5e-12 | 44 |
unnamed | AGK06948.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 5e-12 | 44 |
orfA | AGK06994.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 5e-12 | 44 |
orfA | AGK07052.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 5e-12 | 44 |
trp1329A | CAB46577.1 | IS1329 transposase A | Not tested | HPI | Protein | 7e-14 | 43 |
RS05 | AAP82950.1 | putative transposase | Not tested | PAPI-2 | Protein | 9e-09 | 42 |
orfD | AGK07033.1 | IS1133 transposase; OrfD | Not tested | SGI1 | Protein | 6e-05 | 41 |
orfD | AGK07091.1 | IS1133 transposase; OrfD | Not tested | SGI1 | Protein | 6e-05 | 41 |
l7045 | CAD33744.1 | - | Not tested | PAI I 536 | Protein | 2e-11 | 41 |
orfA | CAE85179.1 | OrfA protein, IS911 | Not tested | PAI V 536 | Protein | 2e-11 | 41 |
unnamed | CAD42047.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 3e-12 | 41 |
unnamed | CAD33780.1 | putative transposase | Not tested | PAI I 536 | Protein | 9e-12 | 41 |
tnpA | CAB61575.1 | transposase A | Not tested | HPI | Protein | 2e-13 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
Psyc_0864 | YP_264151.1 | IS1329/IS3/IS911 transposase | VFG1123 | Protein | 2e-12 | 44 |
Psyc_0864 | YP_264151.1 | IS1329/IS3/IS911 transposase | VFG1485 | Protein | 8e-12 | 41 |
Psyc_0864 | YP_264151.1 | IS1329/IS3/IS911 transposase | VFG1566 | Protein | 1e-12 | 41 |
Psyc_0864 | YP_264151.1 | IS1329/IS3/IS911 transposase | VFG1521 | Protein | 4e-12 | 41 |