Gene Information

Name : Psyc_0765 (Psyc_0765)
Accession : YP_264052.1
Strain : Psychrobacter arcticus 273-4
Genome accession: NC_007204
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 914192 - 914767 bp
Length : 576 bp
Strand : -
Note : Stress protein

DNA sequence :
ATGGCATTATCTCTGAATAAAGGCGGTAATTTATCGCTCACCAAAACAGATCCAAATCTAACCAAATTACTTATTGGTCT
TGGTTGGGATGAGCGCGCAACCTCTGGTGCTGAATTCGATCTTGATGCGAGCGTATTTTTATTAAATGCAGCTGGCAAAG
TACGCGGCGACCATGACTTTATCTTTTATAATCAGCTCAAATCTGATAATGGCGCCGTTGAGCATACCGGTGACAACCGT
ACGGGCGAAGGTGACGGTGATGACGAAGTGGTCAAAGTCAACCTAACGCAAGTACCTGCTGATGTCGATAAAATCGTTGT
CACTGTGACTATCCATGATGCCGCTGCGCGTAGCCAAAATTTCGGACAAGTAGCCAATGCATTTATTCGCGTTGTTAATG
AAGAAACGGGTACTGAAGTGGTCCGTTTTGATTTAGCAGAAGACCACTCTATTGAGACAGCGATGGTATTTGGCGAAGTC
TATCGCCACAATGCCGAATGGAAATTCCGCGCCGTTGGTCAAGGCTATTCAGGTGGTCTACAAGTGATGTGCCAGCAATA
TGGTGTTGATATCTAA

Protein sequence :
MALSLNKGGNLSLTKTDPNLTKLLIGLGWDERATSGAEFDLDASVFLLNAAGKVRGDHDFIFYNQLKSDNGAVEHTGDNR
TGEGDGDDEVVKVNLTQVPADVDKIVVTVTIHDAAARSQNFGQVANAFIRVVNEETGTEVVRFDLAEDHSIETAMVFGEV
YRHNAEWKFRAVGQGYSGGLQVMCQQYGVDI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-68 72
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-65 66
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-66 66
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-66 66
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-55 62
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-55 62
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-55 62
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-55 61
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-25 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-25 42
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 1e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Psyc_0765 YP_264052.1 tellurium resistance protein BAC0389 Protein 1e-65 67
Psyc_0765 YP_264052.1 tellurium resistance protein BAC0390 Protein 3e-59 63