Gene Information

Name : Psyc_0763 (Psyc_0763)
Accession : YP_264050.1
Strain : Psychrobacter arcticus 273-4
Genome accession: NC_007204
Putative virulence/resistance : Resistance
Product : tellurium resistance TerD
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 911675 - 912250 bp
Length : 576 bp
Strand : -
Note : Bacterial stress protein

DNA sequence :
ATGGCTATTAGCTTAACAAAAGGCGGCAACGTAAACTTATCAAAAGAAGCGCCAGGTTTAACCAATATTACTGTCGGTCT
AGGCTGGGATCCACGCGCCACTGACGGTCAAGAATTTGACTTAGATGCGATTGGCTTTTTGGTCAATGAAGCAGGTCAAG
TACGTAATGATCAAGATTTCATCTTCTTTAACAACCTAAAGTCAGACAATGGCGCGGTTGAACACACAGGCGACAACCGT
ACCGGTGAAGGTGATGGCGATGATGAAAAAATCAAAATCAACCTTGCGAGCATTCCAGCTGACGTAAGCAAAGTCGCTAT
CTGTGCCATCATCTATGAAGGTCAAGCTCGCAACCAAAATTTCGGTCAAGTGGGTGACGCTTATATCCGTGTTTTGAACG
ACAATGGCGACGCTGAAATCGCTCGTTATGACCTATCAGAAGACGGCAGTACCGAAACAGCGATGATTTTTGGTGAATTA
TATCGTCATAGTGGCGACTGGAAATTCCGCGCGGTTGGTCAAGGTTTCAGCGGTGGTCTTGGACCATTAGCGGCCTCTTA
CGGCGTCAACGTTTAA

Protein sequence :
MAISLTKGGNVNLSKEAPGLTNITVGLGWDPRATDGQEFDLDAIGFLVNEAGQVRNDQDFIFFNNLKSDNGAVEHTGDNR
TGEGDGDDEKIKINLASIPADVSKVAICAIIYEGQARNQNFGQVGDAYIRVLNDNGDAEIARYDLSEDGSTETAMIFGEL
YRHSGDWKFRAVGQGFSGGLGPLAASYGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 7e-64 65
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-58 63
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-58 63
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-58 63
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 9e-59 63
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 4e-62 63
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-62 63
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-62 63
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-25 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Psyc_0763 YP_264050.1 tellurium resistance TerD BAC0389 Protein 3e-62 64
Psyc_0763 YP_264050.1 tellurium resistance TerD BAC0390 Protein 3e-59 61