Gene Information

Name : Psyc_0731 (Psyc_0731)
Accession : YP_264019.1
Strain : Psychrobacter arcticus 273-4
Genome accession: NC_007204
Putative virulence/resistance : Resistance
Product : small multidrug efflux pump
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 871371 - 871715 bp
Length : 345 bp
Strand : -
Note : -

DNA sequence :
ATGAGTCCTACTACTATTGCTTACAGCTACCTTGGCATCGCCATTATTTGTGAAGTGATTGGCACTACTTTTTTGATGAA
GTCAGAGCAATTCACCCGTGTGGTGCCGACACTCATCATGGGCGGGCTTTATACCATCTCATTTTTCTTGTTGACTCAGA
CACTAAAAACACTACCGCTGGGTATTGCCTATGCGATGTGGGGCGGACTGGGCATTGTGCTCACCTCAGTCATTGGTCTC
GTAATGTTCAAGCAGCACCTCGATACCGCAGCAGTGAGTGGCATTACTATGATTGTGGGTGGCGTCGTTGTGATGAATAT
ATTTTCTAATTCTGTAGGACATTAA

Protein sequence :
MSPTTIAYSYLGIAIICEVIGTTFLMKSEQFTRVVPTLIMGGLYTISFFLLTQTLKTLPLGIAYAMWGGLGIVLTSVIGL
VMFKQHLDTAAVSGITMIVGGVVVMNIFSNSVGH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 4e-13 41
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 4e-13 41
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 4e-13 41
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 4e-13 41
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 4e-13 41
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 4e-13 41
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 4e-13 41
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 4e-13 41
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 4e-13 41
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 4e-13 41
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 4e-13 41
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 4e-13 41
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 4e-13 41
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 6e-13 41
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 4e-13 41
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 4e-13 41
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-13 41
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 6e-13 41
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 4e-13 41
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 4e-13 41
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-13 41
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 6e-13 41
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 4e-13 41
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 4e-13 41
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-13 41
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 6e-13 41
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 4e-13 41
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 4e-13 41
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-13 41
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 6e-13 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Psyc_0731 YP_264019.1 small multidrug efflux pump NC_002695.1.913273.p Protein 1e-14 50
Psyc_0731 YP_264019.1 small multidrug efflux pump BAC0002 Protein 1e-20 50
Psyc_0731 YP_264019.1 small multidrug efflux pump NC_010410.6003348.p0 Protein 1e-20 50
Psyc_0731 YP_264019.1 small multidrug efflux pump CP004022.1.gene1549. Protein 7e-18 50
Psyc_0731 YP_264019.1 small multidrug efflux pump BAC0150 Protein 1e-14 49
Psyc_0731 YP_264019.1 small multidrug efflux pump BAC0325 Protein 2e-15 48
Psyc_0731 YP_264019.1 small multidrug efflux pump BAC0327 Protein 5e-16 46
Psyc_0731 YP_264019.1 small multidrug efflux pump BAC0329 Protein 2e-16 46
Psyc_0731 YP_264019.1 small multidrug efflux pump BAC0377 Protein 8e-17 45
Psyc_0731 YP_264019.1 small multidrug efflux pump BAC0321 Protein 2e-19 44
Psyc_0731 YP_264019.1 small multidrug efflux pump BAC0324 Protein 2e-15 43
Psyc_0731 YP_264019.1 small multidrug efflux pump CP001138.1.gene1489. Protein 5e-15 42
Psyc_0731 YP_264019.1 small multidrug efflux pump BAC0322 Protein 9e-15 42
Psyc_0731 YP_264019.1 small multidrug efflux pump BAC0192 Protein 2e-11 41
Psyc_0731 YP_264019.1 small multidrug efflux pump BAC0323 Protein 2e-13 41
Psyc_0731 YP_264019.1 small multidrug efflux pump BAC0326 Protein 2e-15 41