Name : SH0088 (SH0088) Accession : YP_252003.1 Strain : Staphylococcus haemolyticus JCSC1435 Genome accession: NC_007168 Putative virulence/resistance : Unknown Product : hypothetical protein Function : - COG functional category : I : Lipid transport and metabolism COG ID : COG3425 EC number : - Position : 95677 - 95844 bp Length : 168 bp Strand : + Note : hypothetical protein, similar to 3-hydroxy-3-methylglutaryl CoA synthase [truncated] DNA sequence : ATGCTAGAATCTAGAGAGCAATTATCAGTCGAAGAATACGAAACATTCTTTAACAGATTTGATAATCAAGAATTTGATTT CGAACGTGAATTGACACAAGATCCATATTCAAAAGTATACTTATACAGTATAGAAGACCATATCAGAACATATAAGATAG AGAAATAA Protein sequence : MLESREQLSVEEYETFFNRFDNQEFDFERELTQDPYSKVYLYSIEDHIRTYKIEK |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
unnamed | BAB47630.1 | hypothetical protein | Not tested | Type-III SCCmec | Protein | 2e-19 | 100 |
SACOL0029 | YP_184940.1 | HMG-CoA synthase, truncation | Not tested | Type-I SCCmec | Protein | 2e-19 | 100 |
unnamed | BAA82227.2 | - | Not tested | Type-II SCCmec | Protein | 2e-19 | 100 |
SAMSHR1132_00290 | YP_005324553.1 | HMG-CoA synthase (partial) | Not tested | Type-IIIinv SCCmec | Protein | 2e-19 | 100 |
unnamed | BAG06196.1 | hypothetical protein | Not tested | Type-VII SCCmec | Protein | 2e-19 | 100 |
MW0028 | NP_644843.1 | HMG-CoA synthase | Not tested | Type-IV SCCmec | Protein | 2e-19 | 100 |
SAPIG0039 | YP_005732849.1 | probable HMG-CoA synthase | Not tested | Type-V SCCmec | Protein | 2e-19 | 100 |
SAUSA300_0029 | YP_492749.1 | hypothetical protein | Not tested | Type-IV SCCmec | Protein | 2e-19 | 100 |
SERP2525 | YP_190066.1 | HMG-CoA synthase, truncation | Not tested | Type-II SCCmec | Protein | 2e-19 | 100 |
SH0088 | YP_252003.1 | hypothetical protein | Not tested | SCCmec | Protein | 2e-19 | 100 |
unnamed | BAA94337.1 | hypothetical protein | Not tested | Type-I SCCmec | Protein | 2e-19 | 100 |