Name : SH0060 (SH0060) Accession : YP_251975.1 Strain : Staphylococcus haemolyticus JCSC1435 Genome accession: NC_007168 Putative virulence/resistance : Unknown Product : hypothetical protein Function : - COG functional category : - COG ID : - EC number : - Position : 67448 - 67669 bp Length : 222 bp Strand : + Note : similar to unknown protein DNA sequence : ATGAACCATGAAACCACACAGTCAGACTGTCGAACGATTGCTAACTTCTTAGCAAAGCATAATTATGTATCAATAGTAAA AGGATTAGTACATCATTTCACAGCGATTGAAGATGAAGAAATACTTGATAAAATATATGATGATTTTATGAATGATGACT CTATAACAACGATACTTAACAATGATTTTCAAAATATTATCAATCGCTATTTAACAAAATGA Protein sequence : MNHETTQSDCRTIANFLAKHNYVSIVKGLVHHFTAIEDEEILDKIYDDFMNDDSITTILNNDFQNIINRYLTK |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
SH0060 | YP_251975.1 | hypothetical protein | Not tested | SCCmec | Protein | 5e-28 | 100 |
SAS0028 | YP_042161.1 | hypothetical protein | Not tested | SCC476 | Protein | 1e-21 | 83 |
unnamed | ACL99848.1 | hypothetical protein | Not tested | Type-V SCCmec | Protein | 6e-21 | 80 |
SE0029 | NP_763584.1 | hypothetical protein | Not tested | SCCpbp4 | Protein | 1e-20 | 79 |
unnamed | BAC53817.1 | hypothetical protein | Not tested | SRImec-III and SCCmec-III region | Protein | 9e-21 | 79 |
unnamed | BAB47654.1 | hypothetical protein | Not tested | Type-III SCCmec | Protein | 9e-21 | 79 |