Gene Information

Name : SH0057 (SH0057)
Accession : YP_251972.1
Strain : Staphylococcus haemolyticus JCSC1435
Genome accession: NC_007168
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 66170 - 66508 bp
Length : 339 bp
Strand : +
Note : similar to unknown protein

DNA sequence :
ATGACGCTAAGCAAACAACTTAAAACGTATATTACTGAACGATTTAAATTAAATTATCAAGATACTTGGAGTTGTGAAAC
CGTAGACGCGGTGGCTGAAGACGTATTACCTGAAAAATATATTAAAAATAGTCCACTCGAACATAAAATATTGAACACAT
TTACTTATTATAACGATGAATTACATGAAATCAGTATTTATCCTTTCTTATGCTATTTAGATAAGGAATTAATAGCAATA
GGTTATTTAGATAATTTTGATTTAGACTTTATATTTTTAAATGACACTCATCAAATTATTATTGATGAACGCTACTTGTT
ACAAAAAGGGGGCGAGTAA

Protein sequence :
MTLSKQLKTYITERFKLNYQDTWSCETVDAVAEDVLPEKYIKNSPLEHKILNTFTYYNDELHEISIYPFLCYLDKELIAI
GYLDNFDLDFIFLNDTHQIIIDERYLLQKGGE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SH0057 YP_251972.1 hypothetical protein Not tested SCCmec Protein 1e-39 100
unnamed ACL99845.1 hypothetical protein Not tested Type-V SCCmec Protein 1e-39 97
unnamed BAG06213.1 hypothetical protein Not tested Type-VII SCCmec Protein 1e-39 96
unnamed BAB46981.2 hypothetical protein Not tested Type-IIIinv SCCmec Protein 5e-38 95
SAPIG0051 YP_005732861.1 hypothetical protein Not tested Type-V SCCmec Protein 3e-39 95
unnamed BAD24835.1 hypothetical protein Not tested Type-V SCCmec Protein 1e-36 91
SAS0031 YP_042164.1 hypothetical protein Not tested SCC476 Protein 6e-20 57
SE0055 NP_763610.1 hypothetical protein Not tested SCCpbp4 Protein 2e-18 57
unnamed BAB72110.1 hypothetical protein Not tested Type-IVa SCCmec Protein 2e-18 56
SAMSHR1132_00390 YP_005324562.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 2e-18 56
unnamed BAB72129.1 hypothetical protein Not tested Type-IVb SCCmec Protein 2e-18 56
MW0037 NP_644852.1 hypothetical protein Not tested Type-IV SCCmec Protein 2e-18 56
unnamed BAC67562.1 hypothetical protein Not tested Type-IVc SCCmec Protein 2e-18 56
SE0033 NP_763588.1 hypothetical protein Not tested SCCpbp4 Protein 8e-18 55
unnamed BAB83488.1 - Not tested SCC 12263 Protein 2e-23 55
unnamed BAA94329.1 hypothetical protein Not tested Type-I SCCmec Protein 6e-19 55
SACOL0040 YP_184951.1 hypothetical protein Not tested Type-I SCCmec Protein 8e-19 55
unnamed BAA94661.1 - Not tested Type-II SCCmec Protein 2e-19 54
SAV0060 NP_370584.1 hypothetical protein Not tested Type-II SCCmec Protein 6e-19 54
SAR0058 YP_039529.1 hypothetical protein Not tested Type-II SCCmec Protein 2e-19 54
SA0056 NP_373296.1 hypothetical protein Not tested Type-II SCCmec Protein 2e-19 54
SERP2501 YP_190043.1 hypothetical protein Not tested Type-II SCCmec Protein 2e-19 54
unnamed BAB47598.1 hypothetical protein Not tested Type-III SCCmec Protein 1e-21 49
SSP0034 YP_300124.1 hypothetical protein Not tested SCC15305RM Protein 1e-20 48
unnamed ACL99833.1 hypothetical protein Not tested Type-V SCCmec Protein 2e-20 47
unnamed BAG06192.1 hypothetical protein Not tested Type-VII SCCmec Protein 2e-20 47
unnamed AAL26663.1 unknown Not tested SCCcap1 Protein 7e-21 47
SSP0047 YP_300137.1 hypothetical protein Not tested SCC15305cap Protein 6e-20 47
SARLGA251_00350 YP_005754050.1 hypothetical protein Not tested Type-XI SCCmec Protein 1e-19 46
unnamed BAB47671.1 hypothetical protein Not tested Type-III SCCmec Protein 2e-18 46
unnamed BAC53833.1 hypothetical protein Not tested SRImec-III and SCCmec-III region Protein 2e-18 46