Gene Information

Name : mtrA (jk1635)
Accession : YP_251428.1
Strain : Corynebacterium jeikeium K411
Genome accession: NC_007164
Putative virulence/resistance : Virulence
Product : two-component system response regulator MtrA
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1915132 - 1915809 bp
Length : 678 bp
Strand : -
Note : -

DNA sequence :
GTGGAAACGAAGATTCTGGTGGTCGACGACGACCCGGCTATCGCGGAAATGCTCACCATTGTTTTGCAAGGCGAGGGTTT
TCGCACCGTTGTCGTGGGTGACGGTGTAGAGGCCGTGAAAGCCGCGGAGGAACACAACCCGGACCTCATCCTGCTGGACG
TTATGCTCCCCGGAATGAACGGCATTGACGTGTGCAAGGCGATCCGCGAGACCTCCACGGTGCCGATCGTTATGCTGACC
GCCCGCACTGACACCGTGGACGTGGTGCTGGGCCTGGAATCCGGTGCCGATGACTACGTGCACAAGCCATTCAAGCCGAA
GGAGCTGGTGGCGCGCGTACGGGCCCGCCTACGCCGCACTCCGGAGGAGGCCCCTGCGGAGACGATCGAGGTAGTAGACC
TAAAGATTGATGTGCCCGGGCACCAGGTGATCCGCGATGGCCAGGAGATCGCGCTGACCCCCATCGAGTTTGACCTGCTG
GTTACGCTGGCCTCCCGTCCGCGTCAAGTGTTCTCCCGCGAGGAGTTGCTAGAGCAGGTGTGGGGCTACCGTAAATCCAG
CGATACGCGCCTGGTGAACGTCCACATTCAGCGCCTGCGTTCGAAGGTGGAGAGGGACCCGGACGACCCGAAGATCATCC
AAACCGTCCGCGGGATCGGCTACAAGACCGGCGAATAG

Protein sequence :
METKILVVDDDPAIAEMLTIVLQGEGFRTVVVGDGVEAVKAAEEHNPDLILLDVMLPGMNGIDVCKAIRETSTVPIVMLT
ARTDTVDVVLGLESGADDYVHKPFKPKELVARVRARLRRTPEEAPAETIEVVDLKIDVPGHQVIRDGQEIALTPIEFDLL
VTLASRPRQVFSREELLEQVWGYRKSSDTRLVNVHIQRLRSKVERDPDDPKIIQTVRGIGYKTGE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-37 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-37 43
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_251428.1 two-component system response regulator MtrA AE000516.2.gene3505. Protein 2e-73 70
mtrA YP_251428.1 two-component system response regulator MtrA NC_002952.2859905.p0 Protein 2e-44 48
mtrA YP_251428.1 two-component system response regulator MtrA NC_002758.1121668.p0 Protein 3e-44 48
mtrA YP_251428.1 two-component system response regulator MtrA NC_007622.3794472.p0 Protein 2e-44 48
mtrA YP_251428.1 two-component system response regulator MtrA NC_009641.5332272.p0 Protein 3e-44 48
mtrA YP_251428.1 two-component system response regulator MtrA NC_013450.8614421.p0 Protein 3e-44 48
mtrA YP_251428.1 two-component system response regulator MtrA NC_007793.3914279.p0 Protein 3e-44 48
mtrA YP_251428.1 two-component system response regulator MtrA NC_002745.1124361.p0 Protein 3e-44 48
mtrA YP_251428.1 two-component system response regulator MtrA NC_009782.5559369.p0 Protein 3e-44 48
mtrA YP_251428.1 two-component system response regulator MtrA NC_002951.3237708.p0 Protein 3e-44 48
mtrA YP_251428.1 two-component system response regulator MtrA NC_003923.1003749.p0 Protein 2e-44 48
mtrA YP_251428.1 two-component system response regulator MtrA BAC0125 Protein 2e-33 47
mtrA YP_251428.1 two-component system response regulator MtrA CP000675.2.gene1535. Protein 2e-34 46
mtrA YP_251428.1 two-component system response regulator MtrA NC_012469.1.7685629. Protein 5e-39 45
mtrA YP_251428.1 two-component system response regulator MtrA HE999704.1.gene2815. Protein 9e-42 45
mtrA YP_251428.1 two-component system response regulator MtrA NC_012469.1.7686381. Protein 4e-42 44
mtrA YP_251428.1 two-component system response regulator MtrA BAC0197 Protein 6e-30 44
mtrA YP_251428.1 two-component system response regulator MtrA NC_007622.3794948.p0 Protein 2e-36 43
mtrA YP_251428.1 two-component system response regulator MtrA NC_003923.1003417.p0 Protein 2e-36 43
mtrA YP_251428.1 two-component system response regulator MtrA NC_013450.8614146.p0 Protein 2e-36 43
mtrA YP_251428.1 two-component system response regulator MtrA NC_002951.3238224.p0 Protein 2e-36 43
mtrA YP_251428.1 two-component system response regulator MtrA NC_007793.3914065.p0 Protein 2e-36 43
mtrA YP_251428.1 two-component system response regulator MtrA NC_002758.1121390.p0 Protein 2e-36 43
mtrA YP_251428.1 two-component system response regulator MtrA NC_010079.5776364.p0 Protein 2e-36 43
mtrA YP_251428.1 two-component system response regulator MtrA NC_002952.2859858.p0 Protein 2e-36 43
mtrA YP_251428.1 two-component system response regulator MtrA CP000034.1.gene3834. Protein 3e-25 43
mtrA YP_251428.1 two-component system response regulator MtrA NC_002695.1.915041.p Protein 3e-25 43
mtrA YP_251428.1 two-component system response regulator MtrA AF155139.2.orf0.gene Protein 6e-37 42
mtrA YP_251428.1 two-component system response regulator MtrA CP000647.1.gene4257. Protein 4e-25 42
mtrA YP_251428.1 two-component system response regulator MtrA CP001138.1.gene4273. Protein 2e-25 42
mtrA YP_251428.1 two-component system response regulator MtrA BAC0533 Protein 4e-25 42
mtrA YP_251428.1 two-component system response regulator MtrA CP001918.1.gene5135. Protein 3e-20 42
mtrA YP_251428.1 two-component system response regulator MtrA AF130997.1.orf0.gene Protein 6e-34 41
mtrA YP_251428.1 two-component system response regulator MtrA AF162694.1.orf4.gene Protein 4e-33 41
mtrA YP_251428.1 two-component system response regulator MtrA AE016830.1.gene1681. Protein 4e-41 41
mtrA YP_251428.1 two-component system response regulator MtrA CP001485.1.gene721.p Protein 6e-27 41
mtrA YP_251428.1 two-component system response regulator MtrA FJ349556.1.orf0.gene Protein 7e-34 41
mtrA YP_251428.1 two-component system response regulator MtrA CP004022.1.gene3215. Protein 4e-28 41
mtrA YP_251428.1 two-component system response regulator MtrA BAC0308 Protein 1e-26 41
mtrA YP_251428.1 two-component system response regulator MtrA CP001138.1.gene2239. Protein 4e-35 41
mtrA YP_251428.1 two-component system response regulator MtrA NC_002695.1.916589.p Protein 3e-35 41
mtrA YP_251428.1 two-component system response regulator MtrA BAC0039 Protein 5e-35 41
mtrA YP_251428.1 two-component system response regulator MtrA BAC0596 Protein 4e-35 41
mtrA YP_251428.1 two-component system response regulator MtrA CP000034.1.gene2186. Protein 5e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_251428.1 two-component system response regulator MtrA VFG1389 Protein 1e-30 44
mtrA YP_251428.1 two-component system response regulator MtrA VFG1390 Protein 3e-35 43
mtrA YP_251428.1 two-component system response regulator MtrA VFG1563 Protein 1e-37 43
mtrA YP_251428.1 two-component system response regulator MtrA VFG1702 Protein 1e-37 43
mtrA YP_251428.1 two-component system response regulator MtrA VFG0596 Protein 4e-27 41