Gene Information

Name : Psyr_0812 (Psyr_0812)
Accession : YP_233908.1
Strain : Pseudomonas syringae B728a
Genome accession: NC_007005
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 917011 - 917586 bp
Length : 576 bp
Strand : +
Note : -

DNA sequence :
ATGGCTTTGACTCTGCAAAAAGGTGGCAACCTTTCGCTGTCGAAAACCGACCCGACCCTGACCAACGTATTGATCGGTCT
GGGCTGGGATCCGCGAGCCACTGACGGACAGGATTTCGACCTGGACGCTAGCGCATTCCTGTTGGACGCCAATGGCAAGG
TCCGCAGTGAAGCTGACTTCATTTTCTACAACCAGCTCAAGAGCGCCGACGGCTCCGTCGAGCACACCGGTGACAACCGT
ACCGGTGAAGGTGATGGTGATGACGAAGTGGTCAAGGTCGATCTGACCCGTGTGCCTGCTGACGTCGACAAGATCGCATT
CGTGGTGACCATTCATGACGCAGAAAGTCGTGGCCAGAATTTTGGCCAGGTGAGCCGCTCTTTCATTCGCGTAGTGAATG
AAAAGTCGGGCGCGGAAGTCGTCCGTTACGATCTTGCTGAAGATGCCTCTACCGAAACCGCAATGATCTTCGCTGAGTTG
TACCGCAATAACGGCGAGTGGAAATTCCGCGCCGTTGGTAGCGGTTTCAAGGGGGGCCTAAAAGCATTGGCCAACTCTTT
CGGCATGAATTTCTGA

Protein sequence :
MALTLQKGGNLSLSKTDPTLTNVLIGLGWDPRATDGQDFDLDASAFLLDANGKVRSEADFIFYNQLKSADGSVEHTGDNR
TGEGDGDDEVVKVDLTRVPADVDKIAFVVTIHDAESRGQNFGQVSRSFIRVVNEKSGAEVVRYDLAEDASTETAMIFAEL
YRNNGEWKFRAVGSGFKGGLKALANSFGMNF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-59 79
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-51 69
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-52 69
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-52 69
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 6e-45 64
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-45 64
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-45 64
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-46 64
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-16 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-16 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Psyr_0812 YP_233908.1 stress protein BAC0389 Protein 2e-52 72
Psyr_0812 YP_233908.1 stress protein BAC0390 Protein 8e-48 65